Reviewed,
UniProtKB/Swiss-Prot Q8IXJ6 (SIRT2_HUMAN)
Last modified
February 9, 2010.
Version 87.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: NAD-dependent deacetylase sirtuin-2 EC=3.5.1.- Alternative name(s): SIR2-like protein 2 Short name=SIR2-like | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 389 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | NAD-dependent protein deacetylase, which deacetylates the 'Lys-40' of alpha-tubulin. Involved in the control of mitotic exit in the cell cycle, probably via its role in the regulation of cytoskeleton. Ref.12 Ref.13 |
| Catalytic activity | NAD+ + an acetylprotein = nicotinamide + O-acetyl-ADP-ribose + a protein. Ref.11 |
| Cofactor | Binds 1 zinc ion per subunit. |
| Enzyme regulation | Inhibited by Sirtinol, A3 and M15 small molecules. Inhibited by nicotinamide. |
| Subunit structure | Interacts with HDAC6, suggesting that these proteins belong to a large complex that deacetylate the cytoskeleton. Ref.12 |
| Subcellular location | Cytoplasm › cytoskeleton. Note: Colocalizes with microtubules. Ref.12 Ref.2 Ref.15 |
| Tissue specificity | Widely expressed. Highly expressed in heart, brain and skeletal muscle, while it is weakly expressed in placenta and lung. Down-regulated in many gliomas suggesting that it may act as a tumor suppressor gene in human gliomas possibly through the regulation of microtubule network. Ref.2 Ref.1 Ref.14 |
| Developmental stage | Peaks during mitosis. After mitosis, it is probably degraded by the 26S proteasome. Ref.13 |
| Post-translational modification | Phosphorylated at the G2/M transition of the cell cycle. Ref.13 Ref.16 Ref.17 |
| Miscellaneous | Has some ability to deacetylate histones in vitro, but seeing its subcellular location, this is unlikely in vivo. |
| Sequence similarities | Belongs to the sirtuin family. Contains 1 deacetylase sirtuin-type domain. |
| Sequence caution | The sequence AAF67015.1 differs from that shown. Reason: Frameshift at several positions. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Q9Y569 | 1 | EBI-477232,EBI-1052090 | ||
| GYS1 | P13807 | 1 | EBI-477232,EBI-963094 | |
| HDAC6 | Q9UBN7 | 1 | EBI-477232,EBI-301697 | |
| KAT2A | Q92830-1 | 1 | EBI-477232,EBI-477636 | |
| KAT2A | Q92830-2 | 1 | EBI-477232,EBI-477641 | |
| KAT2B | Q92831 | 2 | EBI-477232,EBI-477430 | |
| KRT78 | Q8N1N4 | 1 | EBI-477232,EBI-1056564 | |
| PHB2 | Q99623 | 1 | EBI-477232,EBI-358348 | |
| RTN4 | Q9NQC3 | 1 | EBI-477232,EBI-715945 | |
| SARS | P49591 | 1 | EBI-477232,EBI-1053431 | |
| SPOP | O43791 | 1 | EBI-477232,EBI-743549 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8IXJ6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8IXJ6-2) The sequence of this isoform differs from the canonical sequence as follows: 1-37: Missing. | ||||||
| Isoform 3 (identifier: Q8IXJ6-3) The sequence of this isoform differs from the canonical sequence as follows: 1-38: MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGEADM → MPLAECPSCRCLSSFRSV | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q8IXJ6-4) The sequence of this isoform differs from the canonical sequence as follows: 266-271: VQPFAS → GRGLAG 272-389: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 2 – 389 | 388 | NAD-dependent deacetylase sirtuin-2 | PRO_0000110258 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 65 – 340 | 276 | Deacetylase sirtuin-type | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 84 – 104 | 21 | NAD By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 167 – 171 | 5 | NAD By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 187 | 1 | Proton acceptor | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 195 | 1 | Zinc | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 200 | 1 | Zinc | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 221 | 1 | Zinc | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 224 | 1 | Zinc | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2 | 1 | N-acetylalanine Ref.17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 23 | 1 | Phosphoserine Ref.17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 25 | 1 | Phosphoserine Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 27 | 1 | Phosphoserine Ref.16 Ref.17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 368 | 1 | Phosphoserine Ref.17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 372 | 1 | Phosphoserine | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 38 | 38 | MAEPD…GEADM → MPLAECPSCRCLSSFRSV in isoform 3. | VSP_008726 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 37 | 37 | Missing in isoform 2. | VSP_008724 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 266 – 271 | 6 | VQPFAS → GRGLAG in isoform 4. | VSP_008727 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 272 – 389 | 118 | Missing in isoform 4. | VSP_008728 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 97 | 1 | R → A: No effect on deacetylase activity. Ref.19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 167 | 1 | Q → A: Reduced deacetylase activity. Ref.19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 168 | 1 | N → A: Abolishes acetylation of alpha-tubulin. Ref.12 Ref.19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 170 | 1 | D → A or N: Reduced deacetylase activity. Ref.19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 187 | 1 | H → Y or A: Loss of function. Abolishes acetylation of alpha-tubulin. No effect on phosphorylation. Ref.12 Ref.13 Ref.11 Ref.1 Ref.19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 199 | 1 | S → N Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 219 | 1 | P → L in CAD43717. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 35 – 44 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 60 – 63 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 64 – 72 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 79 – 83 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 85 – 87 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 89 – 91 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 105 – 109 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 115 – 119 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 121 – 126 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 129 – 138 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 139 – 142 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 147 – 157 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 161 – 166 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 172 – 175 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 180 – 182 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 183 – 185 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 188 – 196 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 198 – 200 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 206 – 214 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 222 – 224 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 227 – 232 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 241 – 249 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 250 – 252 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 255 – 262 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 267 – 273 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 282 – 288 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 295 – 304 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 309 – 311 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 316 – 322 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 324 – 334 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 338 – 354 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of five human cDNAs with homology to the yeast SIR2 gene: Sir2-like proteins (sirtuins) metabolize NAD and may have protein ADP-ribosyltransferase activity." Frye R.A. Biochem. Biophys. Res. Commun. 260:273-279(1999) [PubMed: 10381378] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, MUTAGENESIS OF HIS-187. Tissue: Testis. |
| [2] | "Characterization of a human gene with sequence homology to Saccharomyces cerevisiae SIR2." Afshar G., Murnane J.P. Gene 234:161-168(1999) [PubMed: 10393250] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [3] | "A novel seven transmembrane receptor induced during the early steps of astrocyte differentiation identified by differential expression." De Smet C., Nishimori H., Furnari F.B., Boegler O., Huang H.-J.S., Cavenee W.K. J. Neurochem. 81:575-588(2002) [PubMed: 12065666] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [4] | "Response of autologous T cells to a human melanoma is dominated by individual mutant antigens." Lennerz V., Fatho M., Gentilini C., Lifke A., Woelfel C., Woelfel T. Submitted (AUG-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). |
| [5] | "Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning." Hu R.-M., Han Z.-G., Song H.-D., Peng Y.-D., Huang Q.-H., Ren S.-X., Gu Y.-J., Huang C.-H., Li Y.-B., Jiang C.-L., Fu G., Zhang Q.-H., Gu B.-W., Dai M., Mao Y.-F., Gao G.-F., Rong R., Ye M. Chen J.-L.Proc. Natl. Acad. Sci. U.S.A. 97:9543-9548(2000) [PubMed: 10931946] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Adrenal gland. |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain and Lung. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Lung. |
| [9] | Mei G., Yu W., Gibbs R.A. Submitted (FEB-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 22-389 (ISOFORM 4). Tissue: Brain. |
| [10] | "Identification of a class of small molecule inhibitors of the sirtuin family of NAD-dependent deacetylases by phenotypic screening." Grozinger C.M., Chao E.D., Blackwell H.E., Moazed D., Schreiber S.L. J. Biol. Chem. 276:38837-38843(2001) [PubMed: 11483616] [Abstract] Cited for: INHIBITION BY SIRTINOL; A3 AND M15. |
| [11] | "Conserved enzymatic production and biological effect of O-acetyl-ADP-ribose by silent information regulator 2-like NAD+-dependent deacetylases." Borra M.T., O'Neill F.J., Jackson M.D., Marshall B.L., Verdin E., Foltz K.R., Denu J.M. J. Biol. Chem. 277:12632-12641(2002) [PubMed: 11812793] [Abstract] Cited for: CATALYTIC ACTIVITY, MUTAGENESIS OF HIS-187. |
| [12] | "The human Sir2 ortholog, SIRT2, is an NAD+-dependent tubulin deacetylase." North B.J., Marshall B.L., Borra M.T., Denu J.M., Verdin E. Mol. Cell 11:437-444(2003) [PubMed: 12620231] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH HDAC6, MUTAGENESIS OF ASN-168 AND HIS-187. |
| [13] | "Role for human SIRT2 NAD-dependent deacetylase activity in control of mitotic exit in the cell cycle." Dryden S.C., Nahhas F.A., Nowak J.E., Goustin A.-S., Tainsky M.A. Mol. Cell. Biol. 23:3173-3185(2003) [PubMed: 12697818] [Abstract] Cited for: FUNCTION, DEVELOPMENTAL STAGE, PHOSPHORYLATION, MUTAGENESIS OF HIS-187. |
| [14] | "Proteomics-based identification of differentially expressed genes in human gliomas: down-regulation of SIRT2 gene." Hiratsuka M., Inoue T., Toda T., Kimura N., Shirayoshi Y., Kamitani H., Watanabe T., Ohama E., Tahimic C.G.T., Kurimasa A., Oshimura M. Biochem. Biophys. Res. Commun. 309:558-566(2003) [PubMed: 12963026] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [15] | "Evolutionarily conserved and nonconserved cellular localizations and functions of human SIRT proteins." Michishita E., Park J.Y., Burneskis J.M., Barrett J.C., Horikawa I. Mol. Biol. Cell 16:4623-4635(2005) [PubMed: 16079181] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [16] | "Phosphoproteome of resting human platelets." Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A. J. Proteome Res. 7:526-534(2008) [PubMed: 18088087] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-25 AND SER-27, MASS SPECTROMETRY. Tissue: Platelet. |
| [17] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-23; SER-27 AND SER-368, MASS SPECTROMETRY. |
| [18] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed: 19369195] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-372, MASS SPECTROMETRY. |
| [19] | "Structure of the histone deacetylase SIRT2." Finnin M.S., Donigian J.R., Pavletich N.P. Nat. Struct. Biol. 8:621-625(2001) [PubMed: 11427894] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) OF 34-356 IN COMPLEX WITH ZINC, MUTAGENESIS OF ARG-97; GLN-167; ASN-168; ASP-170 AND HIS-187. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF083107 mRNA. Translation: AAD40850.2. AF095714 mRNA. Translation: AAD45971.1. Different initiation. AY030277 mRNA. Translation: AAK51133.1. AJ505014 mRNA. Translation: CAD43717.1. AF160214 mRNA. Translation: AAF67015.1. Frameshift. AK290716 mRNA. Translation: BAF83405.1. AK314492 mRNA. Translation: BAG37092.1. CH471126 Genomic DNA. Translation: EAW56833.1. CH471126 Genomic DNA. Translation: EAW56835.1. BC003012 mRNA. Translation: AAH03012.1. BC003547 mRNA. Translation: AAH03547.1. AF131800 mRNA. Translation: AAD20046.1. | ||||||||||||
| IPI | IPI00179109. IPI00382551. IPI00382553. IPI00472047. | ||||||||||||
| RefSeq | NP_036369.2. NP_085096.1. | ||||||||||||
| UniGene | Hs.466693 | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q8IXJ6. 13 interactions. | ||||||||||||
| STRING | Q8IXJ6. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q8IXJ6. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q8IXJ6. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000249396; ENSP00000249396; ENSG00000068903; Homo sapiens. [Genome view] | ||||||||||||
| GeneID | 22933. | ||||||||||||
| KEGG | hsa:22933. | ||||||||||||
| UCSC | uc002ojs.1. human. uc002ojt.1. human. uc002oju.1. human. uc010egh.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 22933. | ||||||||||||
| GeneCards | GC19M044061. | ||||||||||||
| H-InvDB | HIX0015103. | ||||||||||||
| HGNC | HGNC:10886. SIRT2. | ||||||||||||
| HPA | CAB004573. HPA011165. | ||||||||||||
| MIM | 604480. gene. | ||||||||||||
| PharmGKB | PA35786. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG14790. | ||||||||||||
| HOGENOM | HBG641281. | ||||||||||||
| HOVERGEN | Q8IXJ6. | ||||||||||||
| OrthoDB | EOG9J6V94. | ||||||||||||
| PhylomeDB | Q8IXJ6. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Pathway_Interaction_DB | hdac_classi_pathway. Signaling events mediated by HDAC Class I. hdac_classiii_pathway. Signaling events mediated by HDAC Class III. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q8IXJ6. | ||||||||||||
| Bgee | Q8IXJ6. | ||||||||||||
| CleanEx | HS_SIRT2. | ||||||||||||
| Genevestigator | Q8IXJ6. | ||||||||||||
| GermOnline | ENSG00000068903. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR017328. NAD-dep_deAcase_SIR2_euk. IPR003000. NAD-dep_histone_deAcase_SIR2. [Graphical view] | ||||||||||||
| PANTHER | PTHR11085. SIR2. 1 hit. | ||||||||||||
| Pfam | PF02146. SIR2. 1 hit. [Graphical view] | ||||||||||||
| PIRSF | PIRSF037938. SIR2_euk. 1 hit. | ||||||||||||
| PROSITE | PS50305. SIRTUIN. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 43669. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | SIRT2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8IXJ6 Secondary accession number(s): A8K3V1 Q9Y6E9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


