Q8IXJ6 (SIR2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 120.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: NAD-dependent protein deacetylase sirtuin-2 EC=3.5.1.- Alternative name(s): Regulatory protein SIR2 homolog 2 SIR2-like protein 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 389 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | NAD-dependent protein deacetylase, which deacetylates internal lysines on histone and non-histone proteins. Deacetylates 'Lys-40' of alpha-tubulin. Involved in the control of mitotic exit in the cell cycle, probably via its role in the regulation of cytoskeleton. Deacetylates PCK1, opposing proteasomal degradation. Deacetylates 'Lys-310' of RELA. Ref.12 Ref.13 Ref.19 Ref.20 |
| Catalytic activity | NAD+ + an acetylprotein = nicotinamide + O-acetyl-ADP-ribose + a protein. Ref.11 |
| Cofactor | Binds 1 zinc ion per subunit. |
| Enzyme regulation | Inhibited by Sirtinol, A3 and M15 small molecules. Inhibited by nicotinamide. |
| Subunit structure | Interacts with HDAC6, suggesting that these proteins belong to a large complex that deacetylate the cytoskeleton. Ref.12 |
| Subcellular location | Cytoplasm › cytoskeleton. Note: Colocalizes with microtubules. Ref.2 Ref.12 Ref.15 |
| Tissue specificity | Widely expressed. Highly expressed in heart, brain and skeletal muscle, while it is weakly expressed in placenta and lung. Down-regulated in many gliomas suggesting that it may act as a tumor suppressor gene in human gliomas possibly through the regulation of microtubule network. Ref.1 Ref.2 Ref.14 |
| Developmental stage | Peaks during mitosis. After mitosis, it is probably degraded by the 26S proteasome. Ref.13 |
| Post-translational modification | Phosphorylated at the G2/M transition of the cell cycle. Ref.13 |
| Miscellaneous | Has some ability to deacetylate histones in vitro, but seeing its subcellular location, this is unlikely in vivo. |
| Sequence similarities | Belongs to the sirtuin family. Class I subfamily. Contains 1 deacetylase sirtuin-type domain. |
| Sequence caution | The sequence AAD45971.1 differs from that shown. Reason: Erroneous initiation. The sequence AAF67015.1 differs from that shown. Reason: Frameshift at several positions. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CDC20 | Q12834 | 2 | EBI-5240785,EBI-367462 | |
| FZR1 | Q9UM11 | 2 | EBI-5240785,EBI-724997 | |
| KAT2B | Q92831 | 4 | EBI-477232,EBI-477430 | |
| RIPK3 | Q9Y572 | 2 | EBI-477232,EBI-298250 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8IXJ6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8IXJ6-2) The sequence of this isoform differs from the canonical sequence as follows: 1-37: Missing. | ||||||
| Isoform 3 (identifier: Q8IXJ6-3) The sequence of this isoform differs from the canonical sequence as follows: 1-38: MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGEADM → MPLAECPSCRCLSSFRSV | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q8IXJ6-4) The sequence of this isoform differs from the canonical sequence as follows: 266-271: VQPFAS → GRGLAG 272-389: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 389 | 389 | NAD-dependent protein deacetylase sirtuin-2 | PRO_0000110258 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 65 – 340 | 276 | Deacetylase sirtuin-type | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 84 – 104 | 21 | NAD By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 167 – 170 | 4 | NAD By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 261 – 263 | 3 | NAD By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 286 – 288 | 3 | NAD By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 187 | 1 | Proton acceptor | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 195 | 1 | Zinc | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 200 | 1 | Zinc | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 221 | 1 | Zinc | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 224 | 1 | Zinc | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 324 | 1 | NAD; via amide nitrogen By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 23 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 38 | 38 | MAEPD…GEADM → MPLAECPSCRCLSSFRSV in isoform 3. | VSP_008726 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 37 | 37 | Missing in isoform 2. | VSP_008724 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 266 – 271 | 6 | VQPFAS → GRGLAG in isoform 4. | VSP_008727 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 272 – 389 | 118 | Missing in isoform 4. | VSP_008728 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 97 | 1 | R → A: No effect on deacetylase activity. Ref.21 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 167 | 1 | Q → A: Reduced deacetylase activity. Ref.21 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 168 | 1 | N → A: Abolishes acetylation of alpha-tubulin. Ref.12 Ref.21 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 170 | 1 | D → A or N: Reduced deacetylase activity. Ref.21 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 187 | 1 | H → Y or A: Loss of function. Abolishes acetylation of alpha-tubulin. No effect on phosphorylation. Ref.1 Ref.11 Ref.12 Ref.13 Ref.21 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 199 | 1 | S → N Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 219 | 1 | P → L in CAD43717. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 35 – 44 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 60 – 63 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 64 – 72 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 79 – 83 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 85 – 87 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 89 – 91 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 105 – 109 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 115 – 119 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 121 – 126 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 129 – 138 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 139 – 142 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 147 – 157 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 161 – 166 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 172 – 175 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 180 – 182 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 183 – 185 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 188 – 196 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 198 – 200 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 206 – 214 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 222 – 224 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 227 – 232 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 241 – 249 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 250 – 252 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 255 – 262 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 267 – 273 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 282 – 288 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 295 – 304 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 309 – 311 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 316 – 322 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 324 – 334 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 338 – 354 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of five human cDNAs with homology to the yeast SIR2 gene: Sir2-like proteins (sirtuins) metabolize NAD and may have protein ADP-ribosyltransferase activity." Frye R.A. Biochem. Biophys. Res. Commun. 260:273-279(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, MUTAGENESIS OF HIS-187. Tissue: Testis. |
| [2] | "Characterization of a human gene with sequence homology to Saccharomyces cerevisiae SIR2." Afshar G., Murnane J.P. Gene 234:161-168(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [3] | "A novel seven transmembrane receptor induced during the early steps of astrocyte differentiation identified by differential expression." De Smet C., Nishimori H., Furnari F.B., Boegler O., Huang H.-J.S., Cavenee W.K. J. Neurochem. 81:575-588(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [4] | "Response of autologous T cells to a human melanoma is dominated by individual mutant antigens." Lennerz V., Fatho M., Gentilini C., Lifke A., Woelfel C., Woelfel T. Submitted (AUG-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). |
| [5] | "Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning." Hu R.-M., Han Z.-G., Song H.-D., Peng Y.-D., Huang Q.-H., Ren S.-X., Gu Y.-J., Huang C.-H., Li Y.-B., Jiang C.-L., Fu G., Zhang Q.-H., Gu B.-W., Dai M., Mao Y.-F., Gao G.-F., Rong R., Ye M. Chen J.-L.Proc. Natl. Acad. Sci. U.S.A. 97:9543-9548(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Adrenal gland. |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain and Lung. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Lung. |
| [9] | Mei G., Yu W., Gibbs R.A. Submitted (FEB-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 22-389 (ISOFORM 4). Tissue: Brain. |
| [10] | "Identification of a class of small molecule inhibitors of the sirtuin family of NAD-dependent deacetylases by phenotypic screening." Grozinger C.M., Chao E.D., Blackwell H.E., Moazed D., Schreiber S.L. J. Biol. Chem. 276:38837-38843(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INHIBITION BY SIRTINOL; A3 AND M15. |
| [11] | "Conserved enzymatic production and biological effect of O-acetyl-ADP-ribose by silent information regulator 2-like NAD+-dependent deacetylases." Borra M.T., O'Neill F.J., Jackson M.D., Marshall B.L., Verdin E., Foltz K.R., Denu J.M. J. Biol. Chem. 277:12632-12641(2002) [PubMed] [Europe PMC] [Abstract] Cited for: CATALYTIC ACTIVITY, MUTAGENESIS OF HIS-187. |
| [12] | "The human Sir2 ortholog, SIRT2, is an NAD+-dependent tubulin deacetylase." North B.J., Marshall B.L., Borra M.T., Denu J.M., Verdin E. Mol. Cell 11:437-444(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH HDAC6, MUTAGENESIS OF ASN-168 AND HIS-187. |
| [13] | "Role for human SIRT2 NAD-dependent deacetylase activity in control of mitotic exit in the cell cycle." Dryden S.C., Nahhas F.A., Nowak J.E., Goustin A.-S., Tainsky M.A. Mol. Cell. Biol. 23:3173-3185(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DEVELOPMENTAL STAGE, PHOSPHORYLATION, MUTAGENESIS OF HIS-187. |
| [14] | "Proteomics-based identification of differentially expressed genes in human gliomas: down-regulation of SIRT2 gene." Hiratsuka M., Inoue T., Toda T., Kimura N., Shirayoshi Y., Kamitani H., Watanabe T., Ohama E., Tahimic C.G.T., Kurimasa A., Oshimura M. Biochem. Biophys. Res. Commun. 309:558-566(2003) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [15] | "Evolutionarily conserved and nonconserved cellular localizations and functions of human SIRT proteins." Michishita E., Park J.Y., Burneskis J.M., Barrett J.C., Horikawa I. Mol. Biol. Cell 16:4623-4635(2005) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [16] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [17] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [18] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Leukemic T-cell. |
| [19] | "SIRT2 regulates NF-kappaB dependent gene expression through deacetylation of p65 Lys310." Rothgiesser K.M., Erener S., Waibel S., Luscher B., Hottiger M.O. J. Cell Sci. 123:4251-4258(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DEACETYLATION OF RELA. |
| [20] | "Acetylation regulates gluconeogenesis by promoting PEPCK1 degradation via recruiting the UBR5 ubiquitin ligase." Jiang W., Wang S., Xiao M., Lin Y., Zhou L., Lei Q., Xiong Y., Guan K.L., Zhao S. Mol. Cell 43:33-44(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DEACETYLATION OF PCK1. |
| [21] | "Structure of the histone deacetylase SIRT2." Finnin M.S., Donigian J.R., Pavletich N.P. Nat. Struct. Biol. 8:621-625(2001) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) OF 34-356 IN COMPLEX WITH ZINC, MUTAGENESIS OF ARG-97; GLN-167; ASN-168; ASP-170 AND HIS-187. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF083107 mRNA. Translation: AAD40850.2. AF095714 mRNA. Translation: AAD45971.1. Different initiation. AY030277 mRNA. Translation: AAK51133.1. AJ505014 mRNA. Translation: CAD43717.1. AF160214 mRNA. Translation: AAF67015.1. Frameshift. AK290716 mRNA. Translation: BAF83405.1. AK314492 mRNA. Translation: BAG37092.1. CH471126 Genomic DNA. Translation: EAW56833.1. CH471126 Genomic DNA. Translation: EAW56835.1. BC003012 mRNA. Translation: AAH03012.1. BC003547 mRNA. Translation: AAH03547.1. AF131800 mRNA. Translation: AAD20046.1. | ||||||||||||||||||
| IPI | IPI00179109. IPI00382551. IPI00382553. IPI00472047. | ||||||||||||||||||
| RefSeq | NP_001180215.1. NM_001193286.1. NP_036369.2. NM_012237.3. NP_085096.1. NM_030593.2. | ||||||||||||||||||
| UniGene | Hs.466693. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q8IXJ6. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q8IXJ6. 12 interactions. | ||||||||||||||||||
| STRING | 9606.ENSP00000249396. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q8IXJ6. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 38258608. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q8IXJ6. | ||||||||||||||||||
| PRIDE | Q8IXJ6. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 22933. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000249396; ENSP00000249396; ENSG00000068903. ENST00000358931; ENSP00000351809; ENSG00000068903. ENST00000392081; ENSP00000375931; ENSG00000068903. | ||||||||||||||||||
| GeneID | 22933. | ||||||||||||||||||
| KEGG | hsa:22933. | ||||||||||||||||||
| UCSC | uc002ojs.2. human. uc002ojt.2. human. uc010egh.2. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 22933. | ||||||||||||||||||
| GeneCards | GC19M039369. | ||||||||||||||||||
| HGNC | HGNC:10886. SIRT2. | ||||||||||||||||||
| HPA | CAB004573. HPA011165. | ||||||||||||||||||
| MIM | 604480. gene. | ||||||||||||||||||
| neXtProt | NX_Q8IXJ6. | ||||||||||||||||||
| PharmGKB | PA35786. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | COG0846. | ||||||||||||||||||
| HOVERGEN | HBG057095. | ||||||||||||||||||
| KO | K11412. | ||||||||||||||||||
| OrthoDB | EOG4BVRTZ. | ||||||||||||||||||
| PhylomeDB | Q8IXJ6. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Pathway_Interaction_DB | hdac_classi_pathway. Signaling events mediated by HDAC Class I. hdac_classiii_pathway. Signaling events mediated by HDAC Class III. | ||||||||||||||||||
| SABIO-RK | Q8IXJ6. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q8IXJ6. | ||||||||||||||||||
| Bgee | Q8IXJ6. | ||||||||||||||||||
| CleanEx | HS_SIRT2. | ||||||||||||||||||
| Genevestigator | Q8IXJ6. | ||||||||||||||||||
| GermOnline | ENSG00000068903. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR017328. NAD-dep_deAcase_SIR2_class_I. IPR003000. Sirtuin. IPR026590. Ssirtuin_cat_dom. [Graphical view] | ||||||||||||||||||
| PANTHER | PTHR11085. PTHR11085. 1 hit. | ||||||||||||||||||
| Pfam | PF02146. SIR2. 1 hit. [Graphical view] | ||||||||||||||||||
| PIRSF | PIRSF037938. SIR2_euk. 1 hit. | ||||||||||||||||||
| PROSITE | PS50305. SIRTUIN. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| BindingDB | Q8IXJ6. | ||||||||||||||||||
| ChEMBL | CHEMBL4462. | ||||||||||||||||||
| ChiTaRS | SIRT2. human. | ||||||||||||||||||
| EvolutionaryTrace | Q8IXJ6. | ||||||||||||||||||
| GenomeRNAi | 22933. | ||||||||||||||||||
| NextBio | 43669. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | SIR2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8IXJ6 Secondary accession number(s): A8K3V1 Q9Y6E9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
