Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mitochondrial Rho GTPase 1

Gene

RHOT1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution.2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi11 – 18GTP 18
Nucleotide bindingi57 – 61GTP 1Sequence analysis5
Nucleotide bindingi118 – 121GTP 1Sequence analysis4
Calcium bindingi197 – 2081CuratedAdd BLAST12
Calcium bindingi317 – 3282CuratedAdd BLAST12
Nucleotide bindingi425 – 432GTP 28
Nucleotide bindingi463 – 467GTP 2Sequence analysis5
Nucleotide bindingi527 – 530GTP 2Sequence analysis4

GO - Molecular functioni

GO - Biological processi

  • cellular homeostasis Source: UniProtKB
  • mitochondrial outer membrane permeabilization Source: UniProtKB
  • mitochondrion transport along microtubule Source: UniProtKB
  • regulation of small GTPase mediated signal transduction Source: Reactome
  • small GTPase mediated signal transduction Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

Calcium, GTP-binding, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-194840. Rho GTPase cycle.
R-HSA-5689880. Ub-specific processing proteases.

Names & Taxonomyi

Protein namesi
Recommended name:
Mitochondrial Rho GTPase 1 (EC:3.6.5.-)
Short name:
MIRO-1
Short name:
hMiro-1
Alternative name(s):
Rac-GTP-binding protein-like protein
Ras homolog gene family member T1
Gene namesi
Name:RHOT1
Synonyms:ARHT1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:21168. RHOT1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 592Mitochondrial intermembraneSequence analysisAdd BLAST592
Transmembranei593 – 615Helical; Anchor for type IV membrane proteinSequence analysisAdd BLAST23
Topological domaini616 – 618CytoplasmicSequence analysis3

GO - Cellular componenti

  • cytosol Source: Reactome
  • integral component of mitochondrial outer membrane Source: UniProtKB
  • membrane Source: UniProtKB
  • mitochondrion Source: ParkinsonsUK-UCL
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion outer membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi13P → V: Causes constitutive activation inducing an aggregation of the mitochondrial network. 3 Publications1
Mutagenesisi18T → N: Causes constitutive inactivation. 2 Publications1
Mutagenesisi208E → K: Abolishes the formation of thread-like mitochondria. 1 Publication1
Mutagenesisi328E → K: Abolishes the formation of thread-like mitochondria. 1 Publication1
Mutagenesisi427K → V: No effect. 1 Publication1
Mutagenesisi432S → N: No effect. 1 Publication1

Organism-specific databases

DisGeNETi55288.
OpenTargetsiENSG00000126858.
PharmGKBiPA134906318.

Polymorphism and mutation databases

DMDMi108860796.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002393131 – 618Mitochondrial Rho GTPase 1Add BLAST618

Post-translational modificationi

Ubiquitinated by PARK2 during mitophagy, leading to its degradation and enhancement of mitophagy. Deubiquitinated by USP30.1 Publication

Keywords - PTMi

Ubl conjugation

Proteomic databases

EPDiQ8IXI2.
MaxQBiQ8IXI2.
PaxDbiQ8IXI2.
PeptideAtlasiQ8IXI2.
PRIDEiQ8IXI2.

PTM databases

iPTMnetiQ8IXI2.
PhosphoSitePlusiQ8IXI2.

Expressioni

Tissue specificityi

Ubiquitously expressed. Expressed at high level in heart and skeletal muscle.1 Publication

Gene expression databases

BgeeiENSG00000126858.
CleanExiHS_RHOT1.
ExpressionAtlasiQ8IXI2. baseline and differential.
GenevisibleiQ8IXI2. HS.

Organism-specific databases

HPAiCAB068223.
CAB068224.
HPA010687.

Interactioni

Subunit structurei

Interacts with the kinesin-binding proteins TRAK1/OIP106 and TRAK2/GRIF1, forming a link between mitochondria and the trafficking apparatus of the microtubules.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
KIF5CO602822EBI-1396430,EBI-717170
Kif5cP565365EBI-1396430,EBI-994504From a different organism.
PARK2O602603EBI-1396430,EBI-716346
PINK1Q9BXM73EBI-1396430,EBI-2846068
TRAK1Q9UPV95EBI-1396430,EBI-1105048

Protein-protein interaction databases

BioGridi120576. 15 interactors.
DIPiDIP-39114N.
IntActiQ8IXI2. 16 interactors.
MINTiMINT-3972897.
STRINGi9606.ENSP00000351132.

Structurei

Secondary structure

1618
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi183 – 196Combined sources14
Beta strandi201 – 204Combined sources4
Helixi206 – 217Combined sources12
Helixi225 – 234Combined sources10
Beta strandi238 – 242Combined sources5
Beta strandi245 – 247Combined sources3
Helixi248 – 259Combined sources12
Beta strandi260 – 262Combined sources3
Helixi266 – 273Combined sources8
Beta strandi280 – 282Combined sources3
Helixi284 – 287Combined sources4
Beta strandi299 – 301Combined sources3
Helixi303 – 316Combined sources14
Beta strandi321 – 324Combined sources4
Helixi326 – 332Combined sources7
Helixi333 – 335Combined sources3
Beta strandi336 – 338Combined sources3
Helixi345 – 347Combined sources3
Helixi359 – 372Combined sources14
Helixi374 – 383Combined sources10
Helixi386 – 389Combined sources4
Helixi395 – 398Combined sources4
Beta strandi399 – 401Combined sources3
Helixi405 – 410Combined sources6
Beta strandi418 – 424Combined sources7
Helixi431 – 438Combined sources8
Helixi443 – 446Combined sources4
Helixi451 – 453Combined sources3
Beta strandi457 – 464Combined sources8
Beta strandi467 – 476Combined sources10
Helixi484 – 487Combined sources4
Beta strandi490 – 497Combined sources8
Turni501 – 503Combined sources3
Helixi504 – 514Combined sources11
Turni515 – 517Combined sources3
Beta strandi518 – 520Combined sources3
Beta strandi522 – 527Combined sources6
Beta strandi537 – 540Combined sources4
Helixi542 – 548Combined sources7
Beta strandi562 – 564Combined sources3
Helixi568 – 577Combined sources10

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5KSOX-ray2.25A411-592[»]
5KSPX-ray2.16A/B411-592[»]
5KSYX-ray2.48A411-592[»]
5KSZX-ray2.50A177-592[»]
5KTYX-ray2.52A177-592[»]
5KU1X-ray2.50A177-592[»]
ProteinModelPortaliQ8IXI2.
SMRiQ8IXI2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 177Miro 1Add BLAST177
Domaini184 – 219EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini304 – 339EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini412 – 561Miro 2Add BLAST150

Sequence similaritiesi

Belongs to the mitochondrial Rho GTPase family.Curated
Contains 2 EF-hand domains.PROSITE-ProRule annotation
Contains 2 Miro domains.Curated

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1707. Eukaryota.
ENOG410XRHW. LUCA.
GeneTreeiENSGT00390000014374.
HOVERGENiHBG079778.
InParanoidiQ8IXI2.
KOiK07870.
OMAiAIMEDYP.
OrthoDBiEOG091G04UF.
PhylomeDBiQ8IXI2.
TreeFamiTF300814.

Family and domain databases

Gene3Di1.10.238.10. 2 hits.
3.40.50.300. 2 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR013566. EF_hand_assoc_1.
IPR013567. EF_hand_assoc_2.
IPR002048. EF_hand_dom.
IPR020860. MIRO_dom.
IPR021181. Mt_Rho_GTPase.
IPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
[Graphical view]
PfamiPF08355. EF_assoc_1. 1 hit.
PF08356. EF_assoc_2. 1 hit.
PF00071. Ras. 1 hit.
[Graphical view]
PIRSFiPIRSF037488. Mt_Rho_GTPase. 1 hit.
SMARTiSM00054. EFh. 2 hits.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 2 hits.
SSF52540. SSF52540. 2 hits.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 2 hits.
PS51423. MIRO. 2 hits.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8IXI2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKKDVRILLV GEPRVGKTSL IMSLVSEEFP EEVPPRAEEI TIPADVTPER
60 70 80 90 100
VPTHIVDYSE AEQSDEQLHQ EISQANVICI VYAVNNKHSI DKVTSRWIPL
110 120 130 140 150
INERTDKDSR LPLILVGNKS DLVEYSSMET ILPIMNQYTE IETCVECSAK
160 170 180 190 200
NLKNISELFY YAQKAVLHPT GPLYCPEEKE MKPACIKALT RIFKISDQDN
210 220 230 240 250
DGTLNDAELN FFQRICFNTP LAPQALEDVK NVVRKHISDG VADSGLTLKG
260 270 280 290 300
FLFLHTLFIQ RGRHETTWTV LRRFGYDDDL DLTPEYLFPL LKIPPDCTTE
310 320 330 340 350
LNHHAYLFLQ STFDKHDLDR DCALSPDELK DLFKVFPYIP WGPDVNNTVC
360 370 380 390 400
TNERGWITYQ GFLSQWTLTT YLDVQRCLEY LGYLGYSILT EQESQASAVT
410 420 430 440 450
VTRDKKIDLQ KKQTQRNVFR CNVIGVKNCG KSGVLQALLG RNLMRQKKIR
460 470 480 490 500
EDHKSYYAIN TVYVYGQEKY LLLHDISESE FLTEAEIICD VVCLVYDVSN
510 520 530 540 550
PKSFEYCARI FKQHFMDSRI PCLIVAAKSD LHEVKQEYSI SPTDFCRKHK
560 570 580 590 600
MPPPQAFTCN TADAPSKDIF VKLTTMAMYP HVTQADLKSS TFWLRASFGA
610
TVFAVLGFAM YKALLKQR
Length:618
Mass (Da):70,784
Last modified:June 13, 2006 - v2
Checksum:iFE47AC3A4AF6F6C2
GO
Isoform 2 (identifier: Q8IXI2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     580-580: P → PEDHYRDRLSRDMGHTDRIENLRKIWVFLKTAL

Show »
Length:650
Mass (Da):74,752
Checksum:i9E2A92E79F9160E1
GO
Isoform 3 (identifier: Q8IXI2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     580-580: P → PEDHYRDRLSRDMGHTDRIENLRKIWVFLKTAFHARLRCMCTCNRCTFCICQNFLNSDLLQSVKNKIFTAVLNR

Show »
Length:691
Mass (Da):79,547
Checksum:i478FF7C2F8DD1986
GO
Isoform 4 (identifier: Q8IXI2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     581-618: Missing.

Note: No experimental confirmation available.
Show »
Length:580
Mass (Da):66,541
Checksum:iEC42DCCD95811BC3
GO
Isoform 5 (identifier: Q8IXI2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     582-618: VTQADLKSST...AMYKALLKQR → ARLRCMCTCN...TAVLNRIISA

Note: No experimental confirmation available.
Show »
Length:625
Mass (Da):71,687
Checksum:i3968C61EE9945024
GO
Isoform 6 (identifier: Q8IXI2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     224-247: QALEDVKNVVRKHISDGVADSGLT → RFGFEQVLVLLFLQFWALLCTKHY
     248-618: Missing.

Note: No experimental confirmation available.
Show »
Length:247
Mass (Da):28,265
Checksum:i3802160B22935376
GO
Isoform 7 (identifier: Q8IXI2-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     580-580: P → PHARLRCMCTCNRCTFCICQNFLNSDLLQSVKNKIFTAVLNR

Note: No experimental confirmation available.
Show »
Length:659
Mass (Da):75,546
Checksum:i82C8A91A753D656F
GO

Sequence cautioni

The sequence AAH41114 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAH68463 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA91969 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB14185 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti75A → V in AAM15734 (Ref. 3) Curated1
Sequence conflicti246L → F in AAH60781 (PubMed:15489334).Curated1
Sequence conflicti246L → F in BAA91969 (PubMed:14702039).Curated1
Sequence conflicti331D → G in AAH60781 (PubMed:15489334).Curated1
Sequence conflicti587L → P in CAD56956 (PubMed:12482879).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_019153224 – 247QALED…DSGLT → RFGFEQVLVLLFLQFWALLC TKHY in isoform 6. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_019154248 – 618Missing in isoform 6. 1 PublicationAdd BLAST371
Alternative sequenceiVSP_019155580P → PEDHYRDRLSRDMGHTDRIE NLRKIWVFLKTAL in isoform 2. 2 Publications1
Alternative sequenceiVSP_019156580P → PEDHYRDRLSRDMGHTDRIE NLRKIWVFLKTAFHARLRCM CTCNRCTFCICQNFLNSDLL QSVKNKIFTAVLNR in isoform 3. 3 Publications1
Alternative sequenceiVSP_047651580P → PHARLRCMCTCNRCTFCICQ NFLNSDLLQSVKNKIFTAVL NR in isoform 7. Curated1
Alternative sequenceiVSP_019157581 – 618Missing in isoform 4. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_019158582 – 618VTQAD…LLKQR → ARLRCMCTCNRCTFCICQNF LNSDLLQSVKNKIFTAVLNR IISA in isoform 5. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ496730 mRNA. Translation: CAD43139.1.
AJ517412 mRNA. Translation: CAD56956.1.
AY094972 mRNA. Translation: AAM15734.1.
AL136929 mRNA. Translation: CAB66863.1.
AK001902 mRNA. Translation: BAA91969.1. Different initiation.
AK022695 mRNA. Translation: BAB14185.1. Different initiation.
AK294407 mRNA. Translation: BAG57659.1.
AC116407 Genomic DNA. No translation available.
AC026620 Genomic DNA. No translation available.
BC015698 mRNA. Translation: AAH15698.1.
BC041114 mRNA. Translation: AAH41114.1. Different initiation.
BC051818 mRNA. Translation: AAH51818.1.
BC060781 mRNA. Translation: AAH60781.2.
BC068463 mRNA. Translation: AAH68463.1. Different initiation.
BC125104 mRNA. Translation: AAI25105.1.
BC125105 mRNA. Translation: AAI25106.1.
CCDSiCCDS32610.1. [Q8IXI2-3]
CCDS32611.1. [Q8IXI2-7]
CCDS32612.1. [Q8IXI2-1]
CCDS74030.1. [Q8IXI2-2]
RefSeqiNP_001028738.1. NM_001033566.2. [Q8IXI2-7]
NP_001028739.2. NM_001033567.2.
NP_001028740.1. NM_001033568.2. [Q8IXI2-3]
NP_001275683.1. NM_001288754.1. [Q8IXI2-2]
NP_001275684.1. NM_001288755.1.
NP_001275687.1. NM_001288758.1.
NP_060777.3. NM_018307.4. [Q8IXI2-1]
UniGeneiHs.655325.

Genome annotation databases

EnsembliENST00000333942; ENSP00000334724; ENSG00000126858. [Q8IXI2-1]
ENST00000358365; ENSP00000351132; ENSG00000126858. [Q8IXI2-3]
ENST00000394692; ENSP00000378184; ENSG00000126858. [Q8IXI2-2]
ENST00000545287; ENSP00000439737; ENSG00000126858. [Q8IXI2-7]
ENST00000581031; ENSP00000464094; ENSG00000126858. [Q8IXI2-5]
ENST00000581094; ENSP00000462669; ENSG00000126858. [Q8IXI2-4]
GeneIDi55288.
KEGGihsa:55288.
UCSCiuc002hgv.4. human. [Q8IXI2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ496730 mRNA. Translation: CAD43139.1.
AJ517412 mRNA. Translation: CAD56956.1.
AY094972 mRNA. Translation: AAM15734.1.
AL136929 mRNA. Translation: CAB66863.1.
AK001902 mRNA. Translation: BAA91969.1. Different initiation.
AK022695 mRNA. Translation: BAB14185.1. Different initiation.
AK294407 mRNA. Translation: BAG57659.1.
AC116407 Genomic DNA. No translation available.
AC026620 Genomic DNA. No translation available.
BC015698 mRNA. Translation: AAH15698.1.
BC041114 mRNA. Translation: AAH41114.1. Different initiation.
BC051818 mRNA. Translation: AAH51818.1.
BC060781 mRNA. Translation: AAH60781.2.
BC068463 mRNA. Translation: AAH68463.1. Different initiation.
BC125104 mRNA. Translation: AAI25105.1.
BC125105 mRNA. Translation: AAI25106.1.
CCDSiCCDS32610.1. [Q8IXI2-3]
CCDS32611.1. [Q8IXI2-7]
CCDS32612.1. [Q8IXI2-1]
CCDS74030.1. [Q8IXI2-2]
RefSeqiNP_001028738.1. NM_001033566.2. [Q8IXI2-7]
NP_001028739.2. NM_001033567.2.
NP_001028740.1. NM_001033568.2. [Q8IXI2-3]
NP_001275683.1. NM_001288754.1. [Q8IXI2-2]
NP_001275684.1. NM_001288755.1.
NP_001275687.1. NM_001288758.1.
NP_060777.3. NM_018307.4. [Q8IXI2-1]
UniGeneiHs.655325.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5KSOX-ray2.25A411-592[»]
5KSPX-ray2.16A/B411-592[»]
5KSYX-ray2.48A411-592[»]
5KSZX-ray2.50A177-592[»]
5KTYX-ray2.52A177-592[»]
5KU1X-ray2.50A177-592[»]
ProteinModelPortaliQ8IXI2.
SMRiQ8IXI2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120576. 15 interactors.
DIPiDIP-39114N.
IntActiQ8IXI2. 16 interactors.
MINTiMINT-3972897.
STRINGi9606.ENSP00000351132.

PTM databases

iPTMnetiQ8IXI2.
PhosphoSitePlusiQ8IXI2.

Polymorphism and mutation databases

DMDMi108860796.

Proteomic databases

EPDiQ8IXI2.
MaxQBiQ8IXI2.
PaxDbiQ8IXI2.
PeptideAtlasiQ8IXI2.
PRIDEiQ8IXI2.

Protocols and materials databases

DNASUi55288.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000333942; ENSP00000334724; ENSG00000126858. [Q8IXI2-1]
ENST00000358365; ENSP00000351132; ENSG00000126858. [Q8IXI2-3]
ENST00000394692; ENSP00000378184; ENSG00000126858. [Q8IXI2-2]
ENST00000545287; ENSP00000439737; ENSG00000126858. [Q8IXI2-7]
ENST00000581031; ENSP00000464094; ENSG00000126858. [Q8IXI2-5]
ENST00000581094; ENSP00000462669; ENSG00000126858. [Q8IXI2-4]
GeneIDi55288.
KEGGihsa:55288.
UCSCiuc002hgv.4. human. [Q8IXI2-1]

Organism-specific databases

CTDi55288.
DisGeNETi55288.
GeneCardsiRHOT1.
HGNCiHGNC:21168. RHOT1.
HPAiCAB068223.
CAB068224.
HPA010687.
MIMi613888. gene.
neXtProtiNX_Q8IXI2.
OpenTargetsiENSG00000126858.
PharmGKBiPA134906318.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1707. Eukaryota.
ENOG410XRHW. LUCA.
GeneTreeiENSGT00390000014374.
HOVERGENiHBG079778.
InParanoidiQ8IXI2.
KOiK07870.
OMAiAIMEDYP.
OrthoDBiEOG091G04UF.
PhylomeDBiQ8IXI2.
TreeFamiTF300814.

Enzyme and pathway databases

ReactomeiR-HSA-194840. Rho GTPase cycle.
R-HSA-5689880. Ub-specific processing proteases.

Miscellaneous databases

ChiTaRSiRHOT1. human.
GeneWikiiRHOT1.
GenomeRNAii55288.
PROiQ8IXI2.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000126858.
CleanExiHS_RHOT1.
ExpressionAtlasiQ8IXI2. baseline and differential.
GenevisibleiQ8IXI2. HS.

Family and domain databases

Gene3Di1.10.238.10. 2 hits.
3.40.50.300. 2 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR013566. EF_hand_assoc_1.
IPR013567. EF_hand_assoc_2.
IPR002048. EF_hand_dom.
IPR020860. MIRO_dom.
IPR021181. Mt_Rho_GTPase.
IPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
[Graphical view]
PfamiPF08355. EF_assoc_1. 1 hit.
PF08356. EF_assoc_2. 1 hit.
PF00071. Ras. 1 hit.
[Graphical view]
PIRSFiPIRSF037488. Mt_Rho_GTPase. 1 hit.
SMARTiSM00054. EFh. 2 hits.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 2 hits.
SSF52540. SSF52540. 2 hits.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 2 hits.
PS51423. MIRO. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMIRO1_HUMAN
AccessioniPrimary (citable) accession number: Q8IXI2
Secondary accession number(s): A4FVB6
, A6NFV0, B4DG48, J9JIH9, Q6NUR3, Q6P9F8, Q6PJG1, Q6YMW8, Q86UB0, Q8IW28, Q8IXJ7, Q9H067, Q9H9N8, Q9NUZ2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: June 13, 2006
Last modified: November 30, 2016
This is version 136 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.