Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8IXI2

- MIRO1_HUMAN

UniProt

Q8IXI2 - MIRO1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Mitochondrial Rho GTPase 1

Gene

RHOT1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution.2 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi11 – 188GTP 1
Nucleotide bindingi57 – 615GTP 1Sequence Analysis
Nucleotide bindingi118 – 1214GTP 1Sequence Analysis
Calcium bindingi197 – 208121CuratedAdd
BLAST
Calcium bindingi317 – 328122CuratedAdd
BLAST
Nucleotide bindingi425 – 4328GTP 2
Nucleotide bindingi463 – 4675GTP 2Sequence Analysis
Nucleotide bindingi527 – 5304GTP 2Sequence Analysis

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
  2. GTPase activity Source: InterPro
  3. GTP binding Source: UniProtKB-KW

GO - Biological processi

  1. cellular homeostasis Source: UniProtKB
  2. mitochondrial outer membrane permeabilization Source: UniProtKB
  3. mitochondrion transport along microtubule Source: UniProtKB
  4. regulation of small GTPase mediated signal transduction Source: Reactome
  5. small GTPase mediated signal transduction Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

Calcium, GTP-binding, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_11051. Rho GTPase cycle.

Names & Taxonomyi

Protein namesi
Recommended name:
Mitochondrial Rho GTPase 1 (EC:3.6.5.-)
Short name:
MIRO-1
Short name:
hMiro-1
Alternative name(s):
Rac-GTP-binding protein-like protein
Ras homolog gene family member T1
Gene namesi
Name:RHOT1
Synonyms:ARHT1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Unplaced

Organism-specific databases

HGNCiHGNC:21168. RHOT1.

Subcellular locationi

Mitochondrion outer membrane 2 Publications; Single-pass type IV membrane protein 2 Publications
Note: Colocalizes with MGARP and RHOT2 at the mitochondria.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 592592Mitochondrial intermembraneSequence AnalysisAdd
BLAST
Transmembranei593 – 61523Helical; Anchor for type IV membrane proteinSequence AnalysisAdd
BLAST
Topological domaini616 – 6183CytoplasmicSequence Analysis

GO - Cellular componenti

  1. cytosol Source: Reactome
  2. integral component of mitochondrial outer membrane Source: UniProtKB
  3. membrane Source: UniProtKB
  4. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion outer membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi13 – 131P → V: Causes constitutive activation inducing an aggregation of the mitochondrial network. 3 Publications
Mutagenesisi18 – 181T → N: Causes constitutive inactivation. 2 Publications
Mutagenesisi208 – 2081E → K: Abolishes the formation of thread-like mitochondria. 1 Publication
Mutagenesisi328 – 3281E → K: Abolishes the formation of thread-like mitochondria. 1 Publication
Mutagenesisi427 – 4271K → V: No effect. 1 Publication
Mutagenesisi432 – 4321S → N: No effect. 1 Publication

Organism-specific databases

PharmGKBiPA134906318.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 618618Mitochondrial Rho GTPase 1PRO_0000239313Add
BLAST

Post-translational modificationi

Ubiquitinated by PARK2 during mitophagy, leading to its degradation and enhancement of mitophagy. Deubiquitinated by USP30.1 Publication

Keywords - PTMi

Ubl conjugation

Proteomic databases

MaxQBiQ8IXI2.
PaxDbiQ8IXI2.
PRIDEiQ8IXI2.

PTM databases

PhosphoSiteiQ8IXI2.

Expressioni

Tissue specificityi

Ubiquitously expressed. Expressed at high level in heart and skeletal muscle.1 Publication

Gene expression databases

BgeeiQ8IXI2.
CleanExiHS_RHOT1.
ExpressionAtlasiQ8IXI2. baseline and differential.
GenevestigatoriQ8IXI2.

Organism-specific databases

HPAiHPA010687.

Interactioni

Subunit structurei

Interacts with the kinesin-binding proteins TRAK1/OIP106 and TRAK2/GRIF1, forming a link between mitochondria and the trafficking apparatus of the microtubules.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
KIF5CO602822EBI-1396430,EBI-717170
Kif5cP565365EBI-1396430,EBI-994504From a different organism.
PARK2O602603EBI-1396430,EBI-716346
PINK1Q9BXM73EBI-1396430,EBI-2846068
TRAK1Q9UPV93EBI-1396430,EBI-1105048

Protein-protein interaction databases

BioGridi120576. 10 interactions.
DIPiDIP-39114N.
IntActiQ8IXI2. 9 interactions.
MINTiMINT-3972897.

Structurei

3D structure databases

ProteinModelPortaliQ8IXI2.
SMRiQ8IXI2. Positions 5-581.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 177177Miro 1Add
BLAST
Domaini184 – 21936EF-hand 1PROSITE-ProRule annotationAdd
BLAST
Domaini304 – 33936EF-hand 2PROSITE-ProRule annotationAdd
BLAST
Domaini412 – 561150Miro 2Add
BLAST

Sequence similaritiesi

Belongs to the mitochondrial Rho GTPase family.Curated
Contains 2 EF-hand domains.PROSITE-ProRule annotation
Contains 2 Miro domains.Curated

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1100.
GeneTreeiENSGT00390000014374.
HOVERGENiHBG079778.
InParanoidiQ8IXI2.
KOiK07870.
OMAiHEISQAN.
OrthoDBiEOG7PK8Z0.
PhylomeDBiQ8IXI2.
TreeFamiTF300814.

Family and domain databases

Gene3Di1.10.238.10. 2 hits.
3.40.50.300. 2 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR013566. EF_hand_assoc_1.
IPR013567. EF_hand_assoc_2.
IPR002048. EF_hand_dom.
IPR020860. MIRO.
IPR013684. MIRO-like.
IPR027417. P-loop_NTPase.
IPR021181. Rho_GTPase_Mt.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
[Graphical view]
PfamiPF13405. EF-hand_6. 1 hit.
PF08355. EF_assoc_1. 1 hit.
PF08356. EF_assoc_2. 1 hit.
PF08477. Miro. 1 hit.
PF00071. Ras. 1 hit.
[Graphical view]
PIRSFiPIRSF037488. Mt_Rho_GTPase. 1 hit.
PRINTSiPR00449. RASTRNSFRMNG.
SMARTiSM00054. EFh. 2 hits.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 2 hits.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 2 hits.
PS51423. MIRO. 2 hits.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8IXI2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKKDVRILLV GEPRVGKTSL IMSLVSEEFP EEVPPRAEEI TIPADVTPER
60 70 80 90 100
VPTHIVDYSE AEQSDEQLHQ EISQANVICI VYAVNNKHSI DKVTSRWIPL
110 120 130 140 150
INERTDKDSR LPLILVGNKS DLVEYSSMET ILPIMNQYTE IETCVECSAK
160 170 180 190 200
NLKNISELFY YAQKAVLHPT GPLYCPEEKE MKPACIKALT RIFKISDQDN
210 220 230 240 250
DGTLNDAELN FFQRICFNTP LAPQALEDVK NVVRKHISDG VADSGLTLKG
260 270 280 290 300
FLFLHTLFIQ RGRHETTWTV LRRFGYDDDL DLTPEYLFPL LKIPPDCTTE
310 320 330 340 350
LNHHAYLFLQ STFDKHDLDR DCALSPDELK DLFKVFPYIP WGPDVNNTVC
360 370 380 390 400
TNERGWITYQ GFLSQWTLTT YLDVQRCLEY LGYLGYSILT EQESQASAVT
410 420 430 440 450
VTRDKKIDLQ KKQTQRNVFR CNVIGVKNCG KSGVLQALLG RNLMRQKKIR
460 470 480 490 500
EDHKSYYAIN TVYVYGQEKY LLLHDISESE FLTEAEIICD VVCLVYDVSN
510 520 530 540 550
PKSFEYCARI FKQHFMDSRI PCLIVAAKSD LHEVKQEYSI SPTDFCRKHK
560 570 580 590 600
MPPPQAFTCN TADAPSKDIF VKLTTMAMYP HVTQADLKSS TFWLRASFGA
610
TVFAVLGFAM YKALLKQR
Length:618
Mass (Da):70,784
Last modified:June 13, 2006 - v2
Checksum:iFE47AC3A4AF6F6C2
GO
Isoform 2 (identifier: Q8IXI2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     580-580: P → PEDHYRDRLSRDMGHTDRIENLRKIWVFLKTAL

Show »
Length:650
Mass (Da):74,752
Checksum:i9E2A92E79F9160E1
GO
Isoform 3 (identifier: Q8IXI2-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     580-580: P → PEDHYRDRLSRDMGHTDRIENLRKIWVFLKTAFHARLRCMCTCNRCTFCICQNFLNSDLLQSVKNKIFTAVLNR

Show »
Length:691
Mass (Da):79,547
Checksum:i478FF7C2F8DD1986
GO
Isoform 4 (identifier: Q8IXI2-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     581-618: Missing.

Note: No experimental confirmation available.

Show »
Length:580
Mass (Da):66,541
Checksum:iEC42DCCD95811BC3
GO
Isoform 5 (identifier: Q8IXI2-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     582-618: VTQADLKSST...AMYKALLKQR → ARLRCMCTCN...TAVLNRIISA

Note: No experimental confirmation available.

Show »
Length:625
Mass (Da):71,687
Checksum:i3968C61EE9945024
GO
Isoform 6 (identifier: Q8IXI2-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     224-247: QALEDVKNVVRKHISDGVADSGLT → RFGFEQVLVLLFLQFWALLCTKHY
     248-618: Missing.

Note: No experimental confirmation available.

Show »
Length:247
Mass (Da):28,265
Checksum:i3802160B22935376
GO
Isoform 7 (identifier: Q8IXI2-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     580-580: P → PHARLRCMCTCNRCTFCICQNFLNSDLLQSVKNKIFTAVLNR

Note: No experimental confirmation available.

Show »
Length:659
Mass (Da):75,546
Checksum:i82C8A91A753D656F
GO

Sequence cautioni

The sequence AAH41114.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence AAH68463.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAA91969.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAB14185.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti75 – 751A → V in AAM15734. 1 PublicationCurated
Sequence conflicti246 – 2461L → F in AAH60781. (PubMed:15489334)Curated
Sequence conflicti246 – 2461L → F in BAA91969. (PubMed:14702039)Curated
Sequence conflicti331 – 3311D → G in AAH60781. (PubMed:15489334)Curated
Sequence conflicti587 – 5871L → P in CAD56956. (PubMed:12482879)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei224 – 24724QALED…DSGLT → RFGFEQVLVLLFLQFWALLC TKHY in isoform 6. 1 PublicationVSP_019153Add
BLAST
Alternative sequencei248 – 618371Missing in isoform 6. 1 PublicationVSP_019154Add
BLAST
Alternative sequencei580 – 5801P → PEDHYRDRLSRDMGHTDRIE NLRKIWVFLKTAL in isoform 2. 2 PublicationsVSP_019155
Alternative sequencei580 – 5801P → PEDHYRDRLSRDMGHTDRIE NLRKIWVFLKTAFHARLRCM CTCNRCTFCICQNFLNSDLL QSVKNKIFTAVLNR in isoform 3. 3 PublicationsVSP_019156
Alternative sequencei580 – 5801P → PHARLRCMCTCNRCTFCICQ NFLNSDLLQSVKNKIFTAVL NR in isoform 7. CuratedVSP_047651
Alternative sequencei581 – 61838Missing in isoform 4. 1 PublicationVSP_019157Add
BLAST
Alternative sequencei582 – 61837VTQAD…LLKQR → ARLRCMCTCNRCTFCICQNF LNSDLLQSVKNKIFTAVLNR IISA in isoform 5. 1 PublicationVSP_019158Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ496730 mRNA. Translation: CAD43139.1.
AJ517412 mRNA. Translation: CAD56956.1.
AY094972 mRNA. Translation: AAM15734.1.
AL136929 mRNA. Translation: CAB66863.1.
AK001902 mRNA. Translation: BAA91969.1. Different initiation.
AK022695 mRNA. Translation: BAB14185.1. Different initiation.
AK294407 mRNA. Translation: BAG57659.1.
AC116407 Genomic DNA. No translation available.
AC026620 Genomic DNA. No translation available.
BC015698 mRNA. Translation: AAH15698.1.
BC041114 mRNA. Translation: AAH41114.1. Different initiation.
BC051818 mRNA. Translation: AAH51818.1.
BC060781 mRNA. Translation: AAH60781.2.
BC068463 mRNA. Translation: AAH68463.1. Different initiation.
BC125104 mRNA. Translation: AAI25105.1.
BC125105 mRNA. Translation: AAI25106.1.
CCDSiCCDS32610.1. [Q8IXI2-3]
CCDS32611.1. [Q8IXI2-7]
CCDS32612.1. [Q8IXI2-1]
CCDS74030.1. [Q8IXI2-2]
RefSeqiNP_001028738.1. NM_001033566.2. [Q8IXI2-7]
NP_001028739.2. NM_001033567.2.
NP_001028740.1. NM_001033568.2. [Q8IXI2-3]
NP_001275683.1. NM_001288754.1. [Q8IXI2-2]
NP_001275684.1. NM_001288755.1.
NP_001275687.1. NM_001288758.1.
NP_060777.3. NM_018307.4. [Q8IXI2-1]
UniGeneiHs.655325.

Genome annotation databases

EnsembliENST00000333942; ENSP00000334724; ENSG00000126858. [Q8IXI2-1]
ENST00000358365; ENSP00000351132; ENSG00000126858. [Q8IXI2-3]
ENST00000394692; ENSP00000378184; ENSG00000126858. [Q8IXI2-2]
ENST00000545287; ENSP00000439737; ENSG00000126858. [Q8IXI2-7]
ENST00000581031; ENSP00000464094; ENSG00000126858. [Q8IXI2-5]
ENST00000581094; ENSP00000462669; ENSG00000126858. [Q8IXI2-4]
GeneIDi55288.
KEGGihsa:55288.
UCSCiuc002hgv.3. human. [Q8IXI2-1]
uc002hgw.3. human. [Q8IXI2-3]
uc010wby.2. human. [Q8IXI2-2]

Polymorphism databases

DMDMi108860796.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ496730 mRNA. Translation: CAD43139.1 .
AJ517412 mRNA. Translation: CAD56956.1 .
AY094972 mRNA. Translation: AAM15734.1 .
AL136929 mRNA. Translation: CAB66863.1 .
AK001902 mRNA. Translation: BAA91969.1 . Different initiation.
AK022695 mRNA. Translation: BAB14185.1 . Different initiation.
AK294407 mRNA. Translation: BAG57659.1 .
AC116407 Genomic DNA. No translation available.
AC026620 Genomic DNA. No translation available.
BC015698 mRNA. Translation: AAH15698.1 .
BC041114 mRNA. Translation: AAH41114.1 . Different initiation.
BC051818 mRNA. Translation: AAH51818.1 .
BC060781 mRNA. Translation: AAH60781.2 .
BC068463 mRNA. Translation: AAH68463.1 . Different initiation.
BC125104 mRNA. Translation: AAI25105.1 .
BC125105 mRNA. Translation: AAI25106.1 .
CCDSi CCDS32610.1. [Q8IXI2-3 ]
CCDS32611.1. [Q8IXI2-7 ]
CCDS32612.1. [Q8IXI2-1 ]
CCDS74030.1. [Q8IXI2-2 ]
RefSeqi NP_001028738.1. NM_001033566.2. [Q8IXI2-7 ]
NP_001028739.2. NM_001033567.2.
NP_001028740.1. NM_001033568.2. [Q8IXI2-3 ]
NP_001275683.1. NM_001288754.1. [Q8IXI2-2 ]
NP_001275684.1. NM_001288755.1.
NP_001275687.1. NM_001288758.1.
NP_060777.3. NM_018307.4. [Q8IXI2-1 ]
UniGenei Hs.655325.

3D structure databases

ProteinModelPortali Q8IXI2.
SMRi Q8IXI2. Positions 5-581.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120576. 10 interactions.
DIPi DIP-39114N.
IntActi Q8IXI2. 9 interactions.
MINTi MINT-3972897.

PTM databases

PhosphoSitei Q8IXI2.

Polymorphism databases

DMDMi 108860796.

Proteomic databases

MaxQBi Q8IXI2.
PaxDbi Q8IXI2.
PRIDEi Q8IXI2.

Protocols and materials databases

DNASUi 55288.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000333942 ; ENSP00000334724 ; ENSG00000126858 . [Q8IXI2-1 ]
ENST00000358365 ; ENSP00000351132 ; ENSG00000126858 . [Q8IXI2-3 ]
ENST00000394692 ; ENSP00000378184 ; ENSG00000126858 . [Q8IXI2-2 ]
ENST00000545287 ; ENSP00000439737 ; ENSG00000126858 . [Q8IXI2-7 ]
ENST00000581031 ; ENSP00000464094 ; ENSG00000126858 . [Q8IXI2-5 ]
ENST00000581094 ; ENSP00000462669 ; ENSG00000126858 . [Q8IXI2-4 ]
GeneIDi 55288.
KEGGi hsa:55288.
UCSCi uc002hgv.3. human. [Q8IXI2-1 ]
uc002hgw.3. human. [Q8IXI2-3 ]
uc010wby.2. human. [Q8IXI2-2 ]

Organism-specific databases

CTDi 55288.
GeneCardsi GC17P030470.
HGNCi HGNC:21168. RHOT1.
HPAi HPA010687.
MIMi 613888. gene.
neXtProti NX_Q8IXI2.
PharmGKBi PA134906318.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1100.
GeneTreei ENSGT00390000014374.
HOVERGENi HBG079778.
InParanoidi Q8IXI2.
KOi K07870.
OMAi HEISQAN.
OrthoDBi EOG7PK8Z0.
PhylomeDBi Q8IXI2.
TreeFami TF300814.

Enzyme and pathway databases

Reactomei REACT_11051. Rho GTPase cycle.

Miscellaneous databases

ChiTaRSi RHOT1. human.
GeneWikii RHOT1.
GenomeRNAii 55288.
NextBioi 59462.
PROi Q8IXI2.
SOURCEi Search...

Gene expression databases

Bgeei Q8IXI2.
CleanExi HS_RHOT1.
ExpressionAtlasi Q8IXI2. baseline and differential.
Genevestigatori Q8IXI2.

Family and domain databases

Gene3Di 1.10.238.10. 2 hits.
3.40.50.300. 2 hits.
InterProi IPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR013566. EF_hand_assoc_1.
IPR013567. EF_hand_assoc_2.
IPR002048. EF_hand_dom.
IPR020860. MIRO.
IPR013684. MIRO-like.
IPR027417. P-loop_NTPase.
IPR021181. Rho_GTPase_Mt.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
[Graphical view ]
Pfami PF13405. EF-hand_6. 1 hit.
PF08355. EF_assoc_1. 1 hit.
PF08356. EF_assoc_2. 1 hit.
PF08477. Miro. 1 hit.
PF00071. Ras. 1 hit.
[Graphical view ]
PIRSFi PIRSF037488. Mt_Rho_GTPase. 1 hit.
PRINTSi PR00449. RASTRNSFRMNG.
SMARTi SM00054. EFh. 2 hits.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 2 hits.
TIGRFAMsi TIGR00231. small_GTP. 1 hit.
PROSITEi PS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 2 hits.
PS51423. MIRO. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete physical map and gene content of the human NF1 tumor suppressor region in human and mouse."
    Jenne D.E., Tinschert S., Dorschner M.O., Hameister H., Stephens K., Kehrer-Sawatzki H.
    Genes Chromosomes Cancer 37:111-120(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  2. "Atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis."
    Fransson A., Ruusala A., Aspenstroem P.
    J. Biol. Chem. 278:6495-6502(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, MUTAGENESIS OF PRO-13 AND THR-18.
  3. "Cloning a novel Rac-GTP binding protein-like gene from human fetal brain."
    Zeng L., Xie Y., Mao Y.
    Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    Tissue: Fetal brain.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Uterus.
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 134-618 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 157-618 (ISOFORM 3).
    Tissue: Amygdala, Placenta and Teratocarcinoma.
  6. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 18-618 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 90-550 (ISOFORM 6).
    Tissue: Brain, Lung, Testis and Uterus.
  8. "Rho GTPases have diverse effects on the organization of the actin filament system."
    Aspenstroem P., Fransson A., Saras J.
    Biochem. J. 377:327-337(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: MUTAGENESIS OF PRO-13.
  9. "The atypical Rho GTPases Miro-1 and Miro-2 have essential roles in mitochondrial trafficking."
    Fransson S., Ruusala A., Aspenstroem P.
    Biochem. Biophys. Res. Commun. 344:500-510(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH TRAK1 AND TRAK2, MUTAGENESIS OF PRO-13; THR-18; GLU-208; GLU-328; LYS-427 AND SER-432.
  10. "HUMMR, a hypoxia- and HIF-1alpha-inducible protein, alters mitochondrial distribution and transport."
    Li Y., Lim S., Hoffman D., Aspenstrom P., Federoff H.J., Rempe D.A.
    J. Cell Biol. 185:1065-1081(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  12. "The mitochondrial deubiquitinase USP30 opposes parkin-mediated mitophagy."
    Bingol B., Tea J.S., Phu L., Reichelt M., Bakalarski C.E., Song Q., Foreman O., Kirkpatrick D.S., Sheng M.
    Nature 510:370-375(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: UBIQUITINATION, DEUBIQUITINATION.

Entry informationi

Entry nameiMIRO1_HUMAN
AccessioniPrimary (citable) accession number: Q8IXI2
Secondary accession number(s): A4FVB6
, A6NFV0, B4DG48, J9JIH9, Q6NUR3, Q6P9F8, Q6PJG1, Q6YMW8, Q86UB0, Q8IW28, Q8IXJ7, Q9H067, Q9H9N8, Q9NUZ2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: June 13, 2006
Last modified: November 26, 2014
This is version 116 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3