Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cadherin-like protein 26

Gene

CDH26

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Keywords - Ligandi

Calcium, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Cadherin-like protein 26
Alternative name(s):
Cadherin-like protein VR20
Gene namesi
Name:CDH26
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

HGNCiHGNC:15902. CDH26.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini27 – 614ExtracellularSequence analysisAdd BLAST588
Transmembranei615 – 635HelicalSequence analysisAdd BLAST21
Topological domaini636 – 852CytoplasmicSequence analysisAdd BLAST217

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi60437.
OpenTargetsiENSG00000124215.
PharmGKBiPA26298.

Polymorphism and mutation databases

BioMutaiCDH26.
DMDMi152031568.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 26Sequence analysisAdd BLAST26
ChainiPRO_000000382927 – 852Cadherin-like protein 26Add BLAST826

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi81N-linked (GlcNAc...)Sequence analysis1
Glycosylationi85N-linked (GlcNAc...)Sequence analysis1
Glycosylationi171N-linked (GlcNAc...)Sequence analysis1
Glycosylationi177N-linked (GlcNAc...)Sequence analysis1
Glycosylationi462N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PRIDEiQ8IXH8.

PTM databases

iPTMnetiQ8IXH8.
PhosphoSitePlusiQ8IXH8.

Expressioni

Gene expression databases

BgeeiENSG00000124215.
CleanExiHS_CDH26.
ExpressionAtlasiQ8IXH8. baseline and differential.
GenevisibleiQ8IXH8. HS.

Organism-specific databases

HPAiHPA015722.
HPA047578.

Structurei

3D structure databases

ProteinModelPortaliQ8IXH8.
SMRiQ8IXH8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini35 – 165Cadherin 1PROSITE-ProRule annotationAdd BLAST131
Domaini166 – 275Cadherin 2PROSITE-ProRule annotationAdd BLAST110
Domaini276 – 396Cadherin 3PROSITE-ProRule annotationAdd BLAST121
Domaini397 – 500Cadherin 4PROSITE-ProRule annotationAdd BLAST104

Domaini

Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain.By similarity

Sequence similaritiesi

Contains 4 cadherin domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00760000118906.
HOVERGENiHBG050769.
InParanoidiQ8IXH8.
OMAiEIRLSGC.
OrthoDBiEOG091G01UR.
PhylomeDBiQ8IXH8.
TreeFamiTF316817.

Family and domain databases

Gene3Di2.60.40.60. 5 hits.
InterProiIPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
[Graphical view]
PfamiPF00028. Cadherin. 3 hits.
[Graphical view]
PRINTSiPR00205. CADHERIN.
SMARTiSM00112. CA. 4 hits.
[Graphical view]
SUPFAMiSSF49313. SSF49313. 5 hits.
PROSITEiPS00232. CADHERIN_1. 2 hits.
PS50268. CADHERIN_2. 4 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8IXH8-1) [UniParc]FASTAAdd to basket
Also known as: a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAMRSGRHPS LLLLLVLLLW LLQVSIIDSV QQETDDLTKQ TKEKIYQPLR
60 70 80 90 100
RSKRRWVITT LELEEEDPGP FPKLIGELFN NMSYNMSLMY LISGPGVDEY
110 120 130 140 150
PEIGLFSLED HENGRIYVHR PVDREMTPSF TVYFDVVERS TGKIVDTSLI
160 170 180 190 200
FNIRISDVND HAPQFPEKEF NITVQENQSA GQPIFQMLAV DLDEENTPNS
210 220 230 240 250
QVLYFLISQT PLLKESGFRV DRLSGEIRLS GCLDYETAPQ FTLLIRARDC
260 270 280 290 300
GEPSLSSTTT VHVDVQEGNN HRPAFTQENY KVQIPEGRAS QGVLRLLVQD
310 320 330 340 350
RDSPFTSAWR AKFNILHGNE EGHFDISTDP ETNEGILNVI KPLDYETRPA
360 370 380 390 400
QSLIIVVENE ERLVFCERGK LQPPRKAAAS ATVSVQVTDA NDPPAFHPQS
410 420 430 440 450
FIVNKEEGAR PGTLLGTFNA MDPDSQIRYE LVHDPANWVS VDKNSGVVIT
460 470 480 490 500
VEPIDRESPH VNNSFYVIII HAVDDGFPPQ TATGTLMLFL SDINDNVPTL
510 520 530 540 550
RPRSRYMEVC ESAVHEPLHI EAEDPDLEPF SDPFTFELDN TWGNAEDTWK
560 570 580 590 600
LGRNWGQSVE LLTLRSLPRG NYLVPLFIGD KQGLSQKQTV HVRICPCASG
610 620 630 640 650
LTCVELADAE VGLHVGALFP VCAAFVALAV ALLFLLRCYF VLEPKRHGCS
660 670 680 690 700
VSNDEGHQTL VMYNAESKGT SAQTWSDVEG QRPALLICTA AAGPTQGVKA
710 720 730 740 750
YPDATMHRQL LAPVEGRMAE TLNQSKERNR FSLSRGCIIP QGRATAGRGL
760 770 780 790 800
PQDIYKEMMP RRLTQTGKRK HGALARTPSF KKVVYDHKED EENKAGRKQR
810 820 830 840 850
SHLFKVMQLR NEQGGVRVQS AHSPSPLNKK ACFPGDYRGE SAGGHNCRAV

SG
Length:852
Mass (Da):95,278
Last modified:July 10, 2007 - v3
Checksum:iA4AD1EF230FE2B11
GO
Isoform 2 (identifier: Q8IXH8-2) [UniParc]FASTAAdd to basket
Also known as: b

The sequence of this isoform differs from the canonical sequence as follows:
     1-667: Missing.
     668-673: KGTSAQ → MKPLIW
     699-699: K → KDLEEVPPSAASQSAQARCALGSWGYGKPFEPRSVKNIHSTP
     725-852: SKERNRFSLS...GGHNCRAVSG → KLHVANVLED...EIYSESGVPS

Note: No experimental confirmation available.
Show »
Length:165
Mass (Da):17,672
Checksum:iB8C412AD6839D3A3
GO
Isoform 3 (identifier: Q8IXH8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     699-699: K → KDLEEVPPSAASQSAQARCALGSWGYGKPFEPRSVKNIHSTP
     725-852: SKERNRFSLS...GGHNCRAVSG → KLHVANVLED...EIYSESGVPS

Show »
Length:832
Mass (Da):92,416
Checksum:i0CEF6129FE255BBB
GO
Isoform 4 (identifier: Q8IXH8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-667: Missing.
     668-673: KGTSAQ → MKPLIW
     725-852: SKERNRFSLS...GGHNCRAVSG → KLHVANVLED...EIYSESGVPS

Show »
Length:124
Mass (Da):13,320
Checksum:iEF11217150A3F3D3
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_055568144I → T.Corresponds to variant rs6015609dbSNPEnsembl.1
Natural variantiVAR_055569301R → G.Corresponds to variant rs11086690dbSNPEnsembl.1
Natural variantiVAR_055570448V → A.Corresponds to variant rs34866303dbSNPEnsembl.1
Natural variantiVAR_055571479P → L.Corresponds to variant rs6071067dbSNPEnsembl.1
Natural variantiVAR_055572615V → L.Corresponds to variant rs194998dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0083331 – 667Missing in isoform 2 and isoform 4. 2 PublicationsAdd BLAST667
Alternative sequenceiVSP_008334668 – 673KGTSAQ → MKPLIW in isoform 2 and isoform 4. 2 Publications6
Alternative sequenceiVSP_008331699K → KDLEEVPPSAASQSAQARCA LGSWGYGKPFEPRSVKNIHS TP in isoform 2 and isoform 3. 1 Publication1
Alternative sequenceiVSP_008332725 – 852SKERN…RAVSG → KLHVANVLEDDPGYLPHVYS EEGECGGAPSLSSLASLEQE LQPDLLDSLGSKATPFEEIY SESGVPS in isoform 2, isoform 3 and isoform 4. 2 PublicationsAdd BLAST128

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK055202 mRNA. Translation: BAG51485.1.
AK074477 mRNA. Translation: BAB85093.1.
AL109928 Genomic DNA. Translation: CAD55556.1.
AL109928 Genomic DNA. Translation: CAD55557.2.
AL109928 Genomic DNA. Translation: CAM28266.1.
AL109928 Genomic DNA. Translation: CAM28267.1.
CH471077 Genomic DNA. Translation: EAW75420.1.
CH471077 Genomic DNA. Translation: EAW75421.1.
BC062570 mRNA. Translation: AAH62570.1.
AF169690 mRNA. Translation: AAF89687.1.
CCDSiCCDS13485.1. [Q8IXH8-4]
CCDS13486.1. [Q8IXH8-2]
RefSeqiNP_068582.2. NM_021810.4. [Q8IXH8-2]
NP_817089.1. NM_177980.2. [Q8IXH8-4]
UniGeneiHs.729046.

Genome annotation databases

EnsembliENST00000244049; ENSP00000244049; ENSG00000124215. [Q8IXH8-5]
ENST00000348616; ENSP00000339390; ENSG00000124215. [Q8IXH8-4]
ENST00000350849; ENSP00000310845; ENSG00000124215. [Q8IXH8-2]
GeneIDi60437.
KEGGihsa:60437.
UCSCiuc002ybe.4. human. [Q8IXH8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK055202 mRNA. Translation: BAG51485.1.
AK074477 mRNA. Translation: BAB85093.1.
AL109928 Genomic DNA. Translation: CAD55556.1.
AL109928 Genomic DNA. Translation: CAD55557.2.
AL109928 Genomic DNA. Translation: CAM28266.1.
AL109928 Genomic DNA. Translation: CAM28267.1.
CH471077 Genomic DNA. Translation: EAW75420.1.
CH471077 Genomic DNA. Translation: EAW75421.1.
BC062570 mRNA. Translation: AAH62570.1.
AF169690 mRNA. Translation: AAF89687.1.
CCDSiCCDS13485.1. [Q8IXH8-4]
CCDS13486.1. [Q8IXH8-2]
RefSeqiNP_068582.2. NM_021810.4. [Q8IXH8-2]
NP_817089.1. NM_177980.2. [Q8IXH8-4]
UniGeneiHs.729046.

3D structure databases

ProteinModelPortaliQ8IXH8.
SMRiQ8IXH8.
ModBaseiSearch...
MobiDBiSearch...

PTM databases

iPTMnetiQ8IXH8.
PhosphoSitePlusiQ8IXH8.

Polymorphism and mutation databases

BioMutaiCDH26.
DMDMi152031568.

Proteomic databases

PRIDEiQ8IXH8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000244049; ENSP00000244049; ENSG00000124215. [Q8IXH8-5]
ENST00000348616; ENSP00000339390; ENSG00000124215. [Q8IXH8-4]
ENST00000350849; ENSP00000310845; ENSG00000124215. [Q8IXH8-2]
GeneIDi60437.
KEGGihsa:60437.
UCSCiuc002ybe.4. human. [Q8IXH8-1]

Organism-specific databases

CTDi60437.
DisGeNETi60437.
GeneCardsiCDH26.
HGNCiHGNC:15902. CDH26.
HPAiHPA015722.
HPA047578.
neXtProtiNX_Q8IXH8.
OpenTargetsiENSG00000124215.
PharmGKBiPA26298.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00760000118906.
HOVERGENiHBG050769.
InParanoidiQ8IXH8.
OMAiEIRLSGC.
OrthoDBiEOG091G01UR.
PhylomeDBiQ8IXH8.
TreeFamiTF316817.

Miscellaneous databases

GenomeRNAii60437.
PROiQ8IXH8.

Gene expression databases

BgeeiENSG00000124215.
CleanExiHS_CDH26.
ExpressionAtlasiQ8IXH8. baseline and differential.
GenevisibleiQ8IXH8. HS.

Family and domain databases

Gene3Di2.60.40.60. 5 hits.
InterProiIPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
[Graphical view]
PfamiPF00028. Cadherin. 3 hits.
[Graphical view]
PRINTSiPR00205. CADHERIN.
SMARTiSM00112. CA. 4 hits.
[Graphical view]
SUPFAMiSSF49313. SSF49313. 5 hits.
PROSITEiPS00232. CADHERIN_1. 2 hits.
PS50268. CADHERIN_2. 4 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCAD26_HUMAN
AccessioniPrimary (citable) accession number: Q8IXH8
Secondary accession number(s): A2A2M5
, B3KNX3, Q6P5Y6, Q8TCH3, Q9BQN4, Q9NRU1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 26, 2003
Last sequence update: July 10, 2007
Last modified: November 30, 2016
This is version 126 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.