Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Spindle and kinetochore-associated protein 3

Gene

SKA3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation (PubMed:19289083, PubMed:19360002, PubMed:23085020). The SKA1 complex is a direct component of the kinetochore-microtubule interface and directly associates with microtubules as oligomeric assemblies (PubMed:19289083, PubMed:19360002). The complex facilitates the processive movement of microspheres along a microtubule in a depolymerization-coupled manner (PubMed:19289083). In the complex, it mediates the microtubule-stimulated oligomerization (PubMed:19289083). Affinity for microtubules is synergistically enhanced in the presence of the ndc-80 complex and may allow the ndc-80 complex to track depolymerizing microtubules (PubMed:23085020).3 Publications

GO - Biological processi

  • cell division Source: UniProtKB-KW
  • chromosome segregation Source: UniProtKB
  • mitotic nuclear division Source: UniProtKB
  • regulation of microtubule polymerization or depolymerization Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Cell cycle, Cell division, Mitosis

Names & Taxonomyi

Protein namesi
Recommended name:
Spindle and kinetochore-associated protein 3
Gene namesi
Name:SKA3
Synonyms:C13orf3, RAMA1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

HGNCiHGNC:20262. SKA3.

Subcellular locationi

GO - Cellular componenti

  • condensed chromosome outer kinetochore Source: UniProtKB
  • cytoplasm Source: UniProtKB-KW
  • kinetochore Source: UniProtKB
  • spindle microtubule Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Centromere, Chromosome, Cytoplasm, Cytoskeleton, Kinetochore, Microtubule

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA165505498.

Polymorphism and mutation databases

BioMutaiSKA3.
DMDMi73620123.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 412412Spindle and kinetochore-associated protein 3PRO_0000089878Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei34 – 341PhosphoserineCombined sources
Modified residuei119 – 1191PhosphoserineCombined sources
Modified residuei139 – 1391PhosphoserineCombined sources
Modified residuei152 – 1521PhosphoserineCombined sources
Modified residuei155 – 1551PhosphoserineCombined sources
Modified residuei159 – 1591PhosphoserineCombined sources
Modified residuei265 – 2651PhosphothreonineCombined sources
Modified residuei267 – 2671PhosphoserineCombined sources
Modified residuei318 – 3181PhosphoserineCombined sources
Modified residuei384 – 3841PhosphothreonineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8IX90.
MaxQBiQ8IX90.
PaxDbiQ8IX90.
PeptideAtlasiQ8IX90.
PRIDEiQ8IX90.

PTM databases

iPTMnetiQ8IX90.
PhosphoSiteiQ8IX90.

Expressioni

Gene expression databases

BgeeiENSG00000165480.
CleanExiHS_C13orf3.
ExpressionAtlasiQ8IX90. baseline and differential.
GenevisibleiQ8IX90. HS.

Organism-specific databases

HPAiHPA039272.
HPA039356.

Interactioni

Subunit structurei

Component of the SKA1 complex, composed of SKA1, SKA2 and SKA3 (PubMed:19289083, PubMed:19360002). The core SKA1 complex is composed of 2 SKA1-SKA2 heterodimers, each heterodimer interacting with a molecule of the SKA3 homodimer (PubMed:19289083, PubMed:19360002). The core SKA1 complex associates with microtubules and forms oligomeric assemblies (PubMed:19289083, PubMed:19360002, PubMed:23085020). Interacts with SKA1; the interaction is direct (PubMed:19289083, PubMed:23085020).3 Publications

Protein-protein interaction databases

BioGridi128691. 43 interactions.
IntActiQ8IX90. 29 interactions.
MINTiMINT-4995391.
STRINGi9606.ENSP00000319417.

Structurei

Secondary structure

1
412
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi3 – 3028Combined sources
Helixi35 – 6632Combined sources
Helixi68 – 9932Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4AJ5X-ray3.321/2/3/4/U/V/W/X/Y/Z1-101[»]
ProteinModelPortaliQ8IX90.
SMRiQ8IX90. Positions 2-101.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the SKA3 family.Curated

Phylogenomic databases

eggNOGiENOG410IM6Y. Eukaryota.
ENOG4111P70. LUCA.
GeneTreeiENSGT00500000045005.
InParanoidiQ8IX90.
OMAiDCETARL.
OrthoDBiEOG091G03IY.
PhylomeDBiQ8IX90.
TreeFamiTF332721.

Family and domain databases

InterProiIPR033341. SKA3.
[Graphical view]
PANTHERiPTHR28543. PTHR28543. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8IX90-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDPIRSFCGK LRSLASTLDC ETARLQRALD GEESDFEDYP MRILYDLHSE
60 70 80 90 100
VQTLKDDVNI LLDKARLENQ EGIDFIKATK VLMEKNSMDI MKIREYFQKY
110 120 130 140 150
GYSPRVKKNS VHEQEAINSD PELSNCENFQ KTDVKDDLSD PPVASSCISE
160 170 180 190 200
KSPRSPQLSD FGLERYIVSQ VLPNPPQAVN NYKEEPVIVT PPTKQSLVKV
210 220 230 240 250
LKTPKCALKM DDFECVTPKL EHFGISEYTM CLNEDYTMGL KNARNNKSEE
260 270 280 290 300
AIDTESRLND NVFATPSPII QQLEKSDAEY TNSPLVPTFC TPGLKIPSTK
310 320 330 340 350
NSIALVSTNY PLSKTNSSSN DLEVEDRTSL VLNSDTCFEN LTDPSSPTIS
360 370 380 390 400
SYENLLRTPT PPEVTKIPED ILQLLSKYNS NLATPIAIKA VPPSKRFLKH
410
GQNIRDVSNK EN
Length:412
Mass (Da):46,359
Last modified:August 16, 2005 - v2
Checksum:iBCC48E527DD8AA84
GO
Isoform 2 (identifier: Q8IX90-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     35-35: D → G
     36-412: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:35
Mass (Da):3,827
Checksum:iA3043098EB66C14B
GO
Isoform 3 (identifier: Q8IX90-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     374-412: LLSKYNSNLATPIAIKAVPPSKRFLKHGQNIRDVSNKEN → KFQWIYPTQKLNKMR

Show »
Length:388
Mass (Da):43,978
Checksum:iF7E81B976A9D04EF
GO

Sequence cautioni

The sequence AAH13418 differs from that shown. Reason: Erroneous translation. Wrong choice of frame.Curated
The sequence BAG37379 differs from that shown. Reason: Frameshift at position 29. Curated
The sequence BAG37379 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAH69950 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence EAX08294 differs from that shown. Reason: Erroneous gene model prediction. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti58 – 581V → I.1 Publication
Corresponds to variant rs11546983 [ dbSNP | Ensembl ].
VAR_057831
Natural varianti254 – 2541T → A.1 Publication
Corresponds to variant rs17345690 [ dbSNP | Ensembl ].
VAR_023113
Natural varianti335 – 3351D → E.1 Publication
Corresponds to variant rs17279819 [ dbSNP | Ensembl ].
VAR_057832

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei35 – 351D → G in isoform 2. 1 PublicationVSP_040527
Alternative sequencei36 – 412377Missing in isoform 2. 1 PublicationVSP_040528Add
BLAST
Alternative sequencei374 – 41239LLSKY…SNKEN → KFQWIYPTQKLNKMR in isoform 3. 1 PublicationVSP_037245Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF361358 mRNA. Translation: AAO13796.1.
AK090584 mRNA. Translation: BAC03484.1.
AK314864 mRNA. Translation: BAG37379.1. Sequence problems.
AL158032 Genomic DNA. Translation: CAH69950.1. Sequence problems.
AL158032 Genomic DNA. Translation: CAM13059.1.
AL158032 Genomic DNA. Translation: CAM13060.1.
CH471075 Genomic DNA. Translation: EAX08293.1.
CH471075 Genomic DNA. Translation: EAX08294.1. Sequence problems.
CH471075 Genomic DNA. Translation: EAX08295.1.
BC013418 mRNA. Translation: AAH13418.1. Sequence problems.
BC048988 mRNA. Translation: AAH48988.1.
CCDSiCCDS31946.1. [Q8IX90-1]
CCDS53856.1. [Q8IX90-3]
RefSeqiNP_001159489.1. NM_001166017.1. [Q8IX90-3]
NP_659498.4. NM_145061.5. [Q8IX90-1]
XP_005266345.1. XM_005266288.3.
UniGeneiHs.88523.

Genome annotation databases

EnsembliENST00000298260; ENSP00000298260; ENSG00000165480. [Q8IX90-2]
ENST00000314759; ENSP00000319417; ENSG00000165480. [Q8IX90-1]
ENST00000400018; ENSP00000382896; ENSG00000165480. [Q8IX90-3]
GeneIDi221150.
KEGGihsa:221150.
UCSCiuc001unt.3. human. [Q8IX90-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF361358 mRNA. Translation: AAO13796.1.
AK090584 mRNA. Translation: BAC03484.1.
AK314864 mRNA. Translation: BAG37379.1. Sequence problems.
AL158032 Genomic DNA. Translation: CAH69950.1. Sequence problems.
AL158032 Genomic DNA. Translation: CAM13059.1.
AL158032 Genomic DNA. Translation: CAM13060.1.
CH471075 Genomic DNA. Translation: EAX08293.1.
CH471075 Genomic DNA. Translation: EAX08294.1. Sequence problems.
CH471075 Genomic DNA. Translation: EAX08295.1.
BC013418 mRNA. Translation: AAH13418.1. Sequence problems.
BC048988 mRNA. Translation: AAH48988.1.
CCDSiCCDS31946.1. [Q8IX90-1]
CCDS53856.1. [Q8IX90-3]
RefSeqiNP_001159489.1. NM_001166017.1. [Q8IX90-3]
NP_659498.4. NM_145061.5. [Q8IX90-1]
XP_005266345.1. XM_005266288.3.
UniGeneiHs.88523.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4AJ5X-ray3.321/2/3/4/U/V/W/X/Y/Z1-101[»]
ProteinModelPortaliQ8IX90.
SMRiQ8IX90. Positions 2-101.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128691. 43 interactions.
IntActiQ8IX90. 29 interactions.
MINTiMINT-4995391.
STRINGi9606.ENSP00000319417.

PTM databases

iPTMnetiQ8IX90.
PhosphoSiteiQ8IX90.

Polymorphism and mutation databases

BioMutaiSKA3.
DMDMi73620123.

Proteomic databases

EPDiQ8IX90.
MaxQBiQ8IX90.
PaxDbiQ8IX90.
PeptideAtlasiQ8IX90.
PRIDEiQ8IX90.

Protocols and materials databases

DNASUi221150.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000298260; ENSP00000298260; ENSG00000165480. [Q8IX90-2]
ENST00000314759; ENSP00000319417; ENSG00000165480. [Q8IX90-1]
ENST00000400018; ENSP00000382896; ENSG00000165480. [Q8IX90-3]
GeneIDi221150.
KEGGihsa:221150.
UCSCiuc001unt.3. human. [Q8IX90-1]

Organism-specific databases

CTDi221150.
GeneCardsiSKA3.
H-InvDBHIX0011164.
HGNCiHGNC:20262. SKA3.
HPAiHPA039272.
HPA039356.
neXtProtiNX_Q8IX90.
PharmGKBiPA165505498.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IM6Y. Eukaryota.
ENOG4111P70. LUCA.
GeneTreeiENSGT00500000045005.
InParanoidiQ8IX90.
OMAiDCETARL.
OrthoDBiEOG091G03IY.
PhylomeDBiQ8IX90.
TreeFamiTF332721.

Miscellaneous databases

GenomeRNAii221150.
PROiQ8IX90.

Gene expression databases

BgeeiENSG00000165480.
CleanExiHS_C13orf3.
ExpressionAtlasiQ8IX90. baseline and differential.
GenevisibleiQ8IX90. HS.

Family and domain databases

InterProiIPR033341. SKA3.
[Graphical view]
PANTHERiPTHR28543. PTHR28543. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiSKA3_HUMAN
AccessioniPrimary (citable) accession number: Q8IX90
Secondary accession number(s): A2A330
, A2A331, B2RBY2, Q5VZV5, Q86WR2, Q8NBG1, Q96D22
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: August 16, 2005
Last modified: September 7, 2016
This is version 116 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.