Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ankyrin repeat and KH domain-containing protein 1

Gene

ANKHD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May play a role as a scaffolding protein that may be associated with the abnormal phenotype of leukemia cells. Isoform 2 may possess an antiapoptotic effect and protect cells during normal cell survival through its regulation of caspases.1 Publication

GO - Molecular functioni

  • poly(A) RNA binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Ankyrin repeat and KH domain-containing protein 1
Alternative name(s):
HIV-1 Vpr-binding ankyrin repeat protein
Multiple ankyrin repeats single KH domain
Short name:
hMASK
Gene namesi
Name:ANKHD1
Synonyms:KIAA1085, MASK, VBARP
ORF Names:PP2500
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:24714. ANKHD1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi54882.
OpenTargetsiENSG00000131503.
ENSG00000254996.
PharmGKBiPA134947858.
PA162376432.

Polymorphism and mutation databases

BioMutaiANKHD1.
DMDMi74750718.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003063261 – 2542Ankyrin repeat and KH domain-containing protein 1Add BLAST2542

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei101PhosphoserineCombined sources1
Modified residuei105PhosphoserineCombined sources1
Modified residuei803PhosphoserineCombined sources1
Modified residuei1540PhosphoserineCombined sources1
Modified residuei1553PhosphothreonineCombined sources1
Modified residuei1632PhosphoserineCombined sources1
Modified residuei1653PhosphothreonineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ8IWZ3.
MaxQBiQ8IWZ3.
PaxDbiQ8IWZ3.
PeptideAtlasiQ8IWZ3.
PRIDEiQ8IWZ3.

PTM databases

iPTMnetiQ8IWZ3.
PhosphoSitePlusiQ8IWZ3.

Expressioni

Tissue specificityi

Ubiquitous with high expression in cervix, spleen and brain. Expressed in hematopoietic cells with increased expression in leukemia cells. Isoform 2 is highly expressed in spleen with almost no expression in muscle and brain.3 Publications

Gene expression databases

BgeeiENSG00000131503.
ExpressionAtlasiQ8IWZ3. baseline and differential.
GenevisibleiQ8IWZ3. HS.

Organism-specific databases

HPAiHPA008718.

Interactioni

Subunit structurei

Interacts with PTPN11. Isoform 2 interacts with HIV-1 VPR.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
DISC1Q9NRI56EBI-1785446,EBI-529989
NFKBIEO002212EBI-359558,EBI-355098

Protein-protein interaction databases

BioGridi120230. 42 interactors.
135698. 24 interactors.
DIPiDIP-36371N.
IntActiQ8IWZ3. 25 interactors.
MINTiMINT-1427756.
STRINGi9606.ENSP00000432016.

Structurei

3D structure databases

ProteinModelPortaliQ8IWZ3.
SMRiQ8IWZ3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati204 – 233ANK 1Add BLAST30
Repeati237 – 266ANK 2Add BLAST30
Repeati271 – 300ANK 3Add BLAST30
Repeati304 – 333ANK 4Add BLAST30
Repeati337 – 366ANK 5Add BLAST30
Repeati371 – 400ANK 6Add BLAST30
Repeati404 – 433ANK 7Add BLAST30
Repeati437 – 466ANK 8Add BLAST30
Repeati470 – 499ANK 9Add BLAST30
Repeati504 – 533ANK 10Add BLAST30
Repeati534 – 563ANK 11Add BLAST30
Repeati567 – 596ANK 12Add BLAST30
Repeati600 – 629ANK 13Add BLAST30
Repeati634 – 663ANK 14Add BLAST30
Repeati667 – 696ANK 15Add BLAST30
Repeati1054 – 1083ANK 16Add BLAST30
Repeati1087 – 1116ANK 17Add BLAST30
Repeati1121 – 1150ANK 18Add BLAST30
Repeati1154 – 1183ANK 19Add BLAST30
Repeati1189 – 1218ANK 20Add BLAST30
Repeati1223 – 1252ANK 21Add BLAST30
Repeati1256 – 1285ANK 22Add BLAST30
Repeati1291 – 1320ANK 23Add BLAST30
Repeati1324 – 1353ANK 24Add BLAST30
Repeati1357 – 1386ANK 25Add BLAST30
Domaini1695 – 1759KHPROSITE-ProRule annotationAdd BLAST65

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili775 – 852Sequence analysisAdd BLAST78
Coiled coili1415 – 1485Sequence analysisAdd BLAST71

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi6 – 94Gly-richAdd BLAST89
Compositional biasi1977 – 2100Ser-richAdd BLAST124
Compositional biasi2291 – 2299Poly-Ser9

Sequence similaritiesi

Belongs to the mask family.Curated
Contains 25 ANK repeats.PROSITE-ProRule annotation
Contains 1 KH domain.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Coiled coil, Repeat

Phylogenomic databases

eggNOGiKOG0504. Eukaryota.
KOG4369. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00840000129677.
HOGENOMiHOG000033942.
HOVERGENiHBG071352.
InParanoidiQ8IWZ3.
KOiK16726.
OMAiKVSGNHQ.
OrthoDBiEOG091G04SM.
PhylomeDBiQ8IWZ3.
TreeFamiTF328552.

Family and domain databases

Gene3Di1.25.40.20. 3 hits.
3.30.1370.10. 1 hit.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR004087. KH_dom.
IPR004088. KH_dom_type_1.
[Graphical view]
PfamiPF12796. Ank_2. 10 hits.
PF00013. KH_1. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 25 hits.
SM00322. KH. 1 hit.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 3 hits.
SSF54791. SSF54791. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 20 hits.
PS50084. KH_TYPE_1. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8IWZ3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLTDSGGGGT SFEEDLDSVA PRSAPAGASE PPPPGGVGLG IRTVRLFGEA
60 70 80 90 100
GPASGVGSSG GGGSGSGTGG GDAALDFKLA AAVLRTGGGG GASGSDEDEV
110 120 130 140 150
SEVESFILDQ EDLDNPVLKT TSEIFLSSTA EGADLRTVDP ETQARLEALL
160 170 180 190 200
EAAGIGKLST ADGKAFADPE VLRRLTSSVS CALDEAAAAL TRMKAENSHN
210 220 230 240 250
AGQVDTRSLA EACSDGDVNA VRKLLDEGRS VNEHTEEGES LLCLACSAGY
260 270 280 290 300
YELAQVLLAM HANVEDRGNK GDITPLMAAS SGGYLDIVKL LLLHDADVNS
310 320 330 340 350
QSATGNTALT YACAGGFVDI VKVLLNEGAN IEDHNENGHT PLMEAASAGH
360 370 380 390 400
VEVARVLLDH GAGINTHSNE FKESALTLAC YKGHLDMVRF LLEAGADQEH
410 420 430 440 450
KTDEMHTALM EACMDGHVEV ARLLLDSGAQ VNMPADSFES PLTLAACGGH
460 470 480 490 500
VELAALLIER GANLEEVNDE GYTPLMEAAR EGHEEMVALL LAQGANINAQ
510 520 530 540 550
TEETQETALT LACCGGFSEV ADFLIKAGAD IELGCSTPLM EASQEGHLEL
560 570 580 590 600
VKYLLASGAN VHATTATGDT ALTYACENGH TDVADVLLQA GADLEHESEG
610 620 630 640 650
GRTPLMKAAR AGHLCTVQFL ISKGANVNRA TANNDHTVVS LACAGGHLAV
660 670 680 690 700
VELLLAHGAD PTHRLKDGST MLIEAAKGGH TNVVSYLLDY PNNVLSVPTT
710 720 730 740 750
DVSQLPPPSQ DQSQVPRVPT HTLAMVVPPQ EPDRTSQENS PALLGVQKGT
760 770 780 790 800
SKQKSSSLQV ADQDLLPSFH PYQPLECIVE ETEGKLNELG QRISAIEKAQ
810 820 830 840 850
LKSLELIQGE PLNKDKIEEL KKNREEQVQK KKKILKELQK VERQLQMKTQ
860 870 880 890 900
QQFTKEYLET KGQKDTVSLH QQCSHRGVFP EGEGDGSLPE DHFSELPQVD
910 920 930 940 950
TILFKDNDVD DEQQSPPSAE QIDFVPVQPL SSPQCNFSSD LGSNGTNSLE
960 970 980 990 1000
LQKVSGNQQI VGQPQIAITG HDQGLLVQEP DGLMVATPAQ TLTDTLDDLI
1010 1020 1030 1040 1050
AAVSTRVPTG SNSSSQTTEC LTPESCSQTT SNVASQSMPP VYPSVDIDAH
1060 1070 1080 1090 1100
TESNHDTALT LACAGGHEEL VSVLIARDAK IEHRDKKGFT PLILAATAGH
1110 1120 1130 1140 1150
VGVVEILLDK GGDIEAQSER TKDTPLSLAC SGGRQEVVDL LLARGANKEH
1160 1170 1180 1190 1200
RNVSDYTPLS LAASGGYVNI IKILLNAGAE INSRTGSKLG ISPLMLAAMN
1210 1220 1230 1240 1250
GHVPAVKLLL DMGSDINAQI ETNRNTALTL ACFQGRAEVV SLLLDRKANV
1260 1270 1280 1290 1300
EHRAKTGLTP LMEAASGGYA EVGRVLLDKG ADVNAPPVPS SRDTALTIAA
1310 1320 1330 1340 1350
DKGHYKFCEL LIHRGAHIDV RNKKGNTPLW LASNGGHFDV VQLLVQAGAD
1360 1370 1380 1390 1400
VDAADNRKIT PLMSAFRKGH VKVVQYLVKE VNQFPSDIEC MRYIATITDK
1410 1420 1430 1440 1450
ELLKKCHQCV ETIVKAKDQQ AAEANKNASI LLKELDLEKS REESRKQALA
1460 1470 1480 1490 1500
AKREKRKEKR KKKKEEQKRK QEEDEENKPK ENSELPEDED EEENDEDVEQ
1510 1520 1530 1540 1550
EVPIEPPSAT TTTTIGISAT SATFTNVFGK KRANVVTTPS TNRKNKKNKT
1560 1570 1580 1590 1600
KETPPTAHLI LPEQHMSLAQ QKADKNKING EPRGGGAGGN SDSDNLDSTD
1610 1620 1630 1640 1650
CNSESSSGGK SQELNFVMDV NSSKYPSLLL HSQEEKTSTA TSKTQTRLEG
1660 1670 1680 1690 1700
EVTPNSLSTS YKTVSLPLSS PNIKLNLTSP KRGQKREEGW KEVVRRSKKL
1710 1720 1730 1740 1750
SVPASVVSRI MGRGGCNITA IQDVTGAHID VDKQKDKNGE RMITIRGGTE
1760 1770 1780 1790 1800
STRYAVQLIN ALIQDPAKEL EDLIPKNHIR TPASTKSIHA NFSSGVGTTA
1810 1820 1830 1840 1850
ASSKNAFPLG APTLVTSQAT TLSTFQPANK LNKNVPTNVR SSFPVSLPLA
1860 1870 1880 1890 1900
YPHPHFALLA AQTMQQIRHP RLPMAQFGGT FSPSPNTWGP FPVRPVNPGN
1910 1920 1930 1940 1950
TNSSPKHNNT SRLPNQNGTV LPSESAGLAT ASCPITVSSV VAASQQLCVT
1960 1970 1980 1990 2000
NTRTPSSVRK QLFACVPKTS PPATVISSVT STCSSLPSVS SAPITSGQAP
2010 2020 2030 2040 2050
TTFLPASTSQ AQLSSQKMES FSAVPPTKEK VSTQDQPMAN LCTPSSTANS
2060 2070 2080 2090 2100
CSSSASNTPG APETHPSSSP TPTSSNTQEE AQPSSVSDLS PMSMPFASNS
2110 2120 2130 2140 2150
EPAPLTLTSP RMVAADNQDT SNLPQLAVPA PRVSHRMQPR GSFYSMVPNA
2160 2170 2180 2190 2200
TIHQDPQSIF VTNPVTLTPP QGPPAAVQLS SAVNIMNGSQ MHINPANKSL
2210 2220 2230 2240 2250
PPTFGPATLF NHFSSLFDSS QVPANQGWGD GPLSSRVATD ASFTVQSAFL
2260 2270 2280 2290 2300
GNSVLGHLEN MHPDNSKAPG FRPPSQRVST SPVGLPSIDP SGSSPSSSSA
2310 2320 2330 2340 2350
PLASFSGIPG TRVFLQGPAP VGTPSFNRQH FSPHPWTSAS NSSTSAPPTL
2360 2370 2380 2390 2400
GQPKGVSASQ DRKIPPPIGT ERLARIRQGG SVAQAPAGTS FVAPVGHSGI
2410 2420 2430 2440 2450
WSFGVNAVSE GLSGWSQSVM GNHPMHQQLS DPSTFSQHQP MERDDSGMVA
2460 2470 2480 2490 2500
PSNIFHQPMA SGFVDFSKGL PISMYGGTII PSHPQLADVP GGPLFNGLHN
2510 2520 2530 2540
PDPAWNPMIK VIQNSTECTD AQQIWPGTWA PHIGNMHLKY VN
Length:2,542
Mass (Da):269,458
Last modified:March 1, 2003 - v1
Checksum:iAB310E826A4134D0
GO
Isoform 2 (identifier: Q8IWZ3-2) [UniParc]FASTAAdd to basket
Also known as: VBARP-L

The sequence of this isoform differs from the canonical sequence as follows:
     595-627: EHESEGGRTPLMKAARAGHLCTVQFLISKGANV → DKQEDMKTILEGIDPAKHQVRVAFDACKLLRKE
     628-2542: Missing.

Show »
Length:627
Mass (Da):64,912
Checksum:i141288C8EC9A42CB
GO
Isoform 3 (identifier: Q8IWZ3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-164: Missing.
     595-627: EHESEGGRTPLMKAARAGHLCTVQFLISKGANV → DKQEDMKTILEGIDPAKHQVRVAFDACKLLRKE
     628-2542: Missing.

Show »
Length:616
Mass (Da):63,884
Checksum:i813BEFD05BB8753B
GO
Isoform 4 (identifier: Q8IWZ3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2342-2343: SS → SCDSPIPSVSSGSSSPLSA
     2524-2542: IWPGTWAPHIGNMHLKYVN → VKWA

Show »
Length:2,544
Mass (Da):269,298
Checksum:iCF2D5BAF8FF3D40D
GO
Isoform 5 (identifier: Q8IWZ3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     559-581: ANVHATTATGDTALTYACENGHT → QAGGHEDYFGGHRSGQASGEGGL
     582-2542: Missing.

Show »
Length:581
Mass (Da):59,777
Checksum:i1909744ED03FC919
GO
Isoform 6 (identifier: Q8IWZ3-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2524-2542: IWPGTWAPHIGNMHLKYVN → ASLLPSVPAL...GAGDRGRDTR

Show »
Length:2,617
Mass (Da):277,175
Checksum:i2C93ED2B397C7CA6
GO

Sequence cautioni

The sequence BAA91417 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB13958 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_035291175L → M.1 PublicationCorresponds to variant rs17850570dbSNPEnsembl.1
Natural variantiVAR_035292228G → C.1 PublicationCorresponds to variant rs17850572dbSNPEnsembl.1
Natural variantiVAR_0482811586G → S.Corresponds to variant rs1051309dbSNPEnsembl.1
Natural variantiVAR_0352931760N → S.Corresponds to variant rs3752704dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_028452154 – 164Missing in isoform 3. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_028453559 – 581ANVHA…ENGHT → QAGGHEDYFGGHRSGQASGE GGL in isoform 5. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_028454582 – 2542Missing in isoform 5. 1 PublicationAdd BLAST1961
Alternative sequenceiVSP_028455595 – 627EHESE…KGANV → DKQEDMKTILEGIDPAKHQV RVAFDACKLLRKE in isoform 2 and isoform 3. 3 PublicationsAdd BLAST33
Alternative sequenceiVSP_028456628 – 2542Missing in isoform 2 and isoform 3. 3 PublicationsAdd BLAST1915
Alternative sequenceiVSP_0284572342 – 2343SS → SCDSPIPSVSSGSSSPLSA in isoform 4. 1 Publication2
Alternative sequenceiVSP_0284582524 – 2542IWPGT…LKYVN → VKWA in isoform 4. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_0442312524 – 2542IWPGT…LKYVN → ASLLPSVPALKGEIPSPQLT RPKKRIGRPMVASPNQRHQD HLRPKVPAGVQELTHCPDTP LLPPSDSRGHNSSNSPSLQA GGAEGAGDRGRDTR in isoform 6. 1 PublicationAdd BLAST19

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF521882 mRNA. Translation: AAO14943.1.
AF521883 mRNA. Translation: AAO14944.1.
AF258557 mRNA. Translation: AAG23760.1.
AC008438 Genomic DNA. No translation available.
AC011399 Genomic DNA. No translation available.
CH471062 Genomic DNA. Translation: EAW62055.1.
CH471062 Genomic DNA. Translation: EAW62058.1.
BC004457 mRNA. Translation: AAH04457.2.
BC009420 mRNA. Translation: AAH09420.1.
BC009909 mRNA. Translation: AAH09909.1.
BC117677 mRNA. Translation: AAI17678.1.
BC117678 mRNA. Translation: AAI17679.1.
BC127127 mRNA. Translation: AAI27128.1.
BC150486 mRNA. Translation: AAI50487.1.
AK000904 mRNA. Translation: BAA91417.1. Different initiation.
AK022041 mRNA. Translation: BAB13958.1. Different initiation.
AF217646 mRNA. Translation: AAG41779.1.
AB029008 mRNA. Translation: BAA83037.1.
CCDSiCCDS4225.1. [Q8IWZ3-1]
CCDS43371.1. [Q8IWZ3-2]
CCDS43372.1. [Q8IWZ3-3]
CCDS75319.1. [Q8IWZ3-5]
RefSeqiNP_001183959.1. NM_001197030.1. [Q8IWZ3-5]
NP_060217.1. NM_017747.2. [Q8IWZ3-1]
NP_060448.1. NM_017978.2. [Q8IWZ3-3]
NP_065741.3. NM_020690.5. [Q8IWZ3-6]
NP_078944.2. NM_024668.3. [Q8IWZ3-2]
UniGeneiHs.594084.

Genome annotation databases

EnsembliENST00000360839; ENSP00000354085; ENSG00000131503. [Q8IWZ3-1]
ENST00000394722; ENSP00000378211; ENSG00000131503. [Q8IWZ3-3]
ENST00000394723; ENSP00000378212; ENSG00000131503. [Q8IWZ3-2]
ENST00000616482; ENSP00000478529; ENSG00000131503. [Q8IWZ3-5]
GeneIDi404734.
54882.
KEGGihsa:404734.
hsa:54882.
UCSCiuc003lfo.4. human. [Q8IWZ3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF521882 mRNA. Translation: AAO14943.1.
AF521883 mRNA. Translation: AAO14944.1.
AF258557 mRNA. Translation: AAG23760.1.
AC008438 Genomic DNA. No translation available.
AC011399 Genomic DNA. No translation available.
CH471062 Genomic DNA. Translation: EAW62055.1.
CH471062 Genomic DNA. Translation: EAW62058.1.
BC004457 mRNA. Translation: AAH04457.2.
BC009420 mRNA. Translation: AAH09420.1.
BC009909 mRNA. Translation: AAH09909.1.
BC117677 mRNA. Translation: AAI17678.1.
BC117678 mRNA. Translation: AAI17679.1.
BC127127 mRNA. Translation: AAI27128.1.
BC150486 mRNA. Translation: AAI50487.1.
AK000904 mRNA. Translation: BAA91417.1. Different initiation.
AK022041 mRNA. Translation: BAB13958.1. Different initiation.
AF217646 mRNA. Translation: AAG41779.1.
AB029008 mRNA. Translation: BAA83037.1.
CCDSiCCDS4225.1. [Q8IWZ3-1]
CCDS43371.1. [Q8IWZ3-2]
CCDS43372.1. [Q8IWZ3-3]
CCDS75319.1. [Q8IWZ3-5]
RefSeqiNP_001183959.1. NM_001197030.1. [Q8IWZ3-5]
NP_060217.1. NM_017747.2. [Q8IWZ3-1]
NP_060448.1. NM_017978.2. [Q8IWZ3-3]
NP_065741.3. NM_020690.5. [Q8IWZ3-6]
NP_078944.2. NM_024668.3. [Q8IWZ3-2]
UniGeneiHs.594084.

3D structure databases

ProteinModelPortaliQ8IWZ3.
SMRiQ8IWZ3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120230. 42 interactors.
135698. 24 interactors.
DIPiDIP-36371N.
IntActiQ8IWZ3. 25 interactors.
MINTiMINT-1427756.
STRINGi9606.ENSP00000432016.

PTM databases

iPTMnetiQ8IWZ3.
PhosphoSitePlusiQ8IWZ3.

Polymorphism and mutation databases

BioMutaiANKHD1.
DMDMi74750718.

Proteomic databases

EPDiQ8IWZ3.
MaxQBiQ8IWZ3.
PaxDbiQ8IWZ3.
PeptideAtlasiQ8IWZ3.
PRIDEiQ8IWZ3.

Protocols and materials databases

DNASUi54882.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000360839; ENSP00000354085; ENSG00000131503. [Q8IWZ3-1]
ENST00000394722; ENSP00000378211; ENSG00000131503. [Q8IWZ3-3]
ENST00000394723; ENSP00000378212; ENSG00000131503. [Q8IWZ3-2]
ENST00000616482; ENSP00000478529; ENSG00000131503. [Q8IWZ3-5]
GeneIDi404734.
54882.
KEGGihsa:404734.
hsa:54882.
UCSCiuc003lfo.4. human. [Q8IWZ3-1]

Organism-specific databases

CTDi404734.
54882.
DisGeNETi54882.
GeneCardsiANKHD1.
HGNCiHGNC:24714. ANKHD1.
HPAiHPA008718.
MIMi610500. gene.
neXtProtiNX_Q8IWZ3.
OpenTargetsiENSG00000131503.
ENSG00000254996.
PharmGKBiPA134947858.
PA162376432.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0504. Eukaryota.
KOG4369. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00840000129677.
HOGENOMiHOG000033942.
HOVERGENiHBG071352.
InParanoidiQ8IWZ3.
KOiK16726.
OMAiKVSGNHQ.
OrthoDBiEOG091G04SM.
PhylomeDBiQ8IWZ3.
TreeFamiTF328552.

Miscellaneous databases

ChiTaRSiANKHD1. human.
GeneWikiiANKHD1.
PROiQ8IWZ3.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000131503.
ExpressionAtlasiQ8IWZ3. baseline and differential.
GenevisibleiQ8IWZ3. HS.

Family and domain databases

Gene3Di1.25.40.20. 3 hits.
3.30.1370.10. 1 hit.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR004087. KH_dom.
IPR004088. KH_dom_type_1.
[Graphical view]
PfamiPF12796. Ank_2. 10 hits.
PF00013. KH_1. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 25 hits.
SM00322. KH. 1 hit.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 3 hits.
SSF54791. SSF54791. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 20 hits.
PS50084. KH_TYPE_1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiANKH1_HUMAN
AccessioniPrimary (citable) accession number: Q8IWZ3
Secondary accession number(s): A6NH85
, Q149P2, Q8IWZ2, Q8WY90, Q96G77, Q96GK0, Q9H2U0, Q9HA95, Q9NWG4, Q9UPR7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: March 1, 2003
Last modified: November 30, 2016
This is version 130 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.