Q8IWZ3 (ANKH1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 81.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ankyrin repeat and KH domain-containing protein 1 Alternative name(s): HIV-1 Vpr-binding ankyrin repeat protein Multiple ankyrin repeats single KH domain Short name=hMASK | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 2542 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play a role as a scaffolding protein that may be associated with the abnormal phenotype of leukemia cells. Isoform 2 may possess an antiapoptotic effect and protect cells during normal cell survival through its regulation of caspases. Ref.9 |
| Subunit structure | Interacts with PTPN11. Isoform 2 interacts with HIV-1 VPR. Ref.9 Ref.10 |
| Subcellular location | |
| Tissue specificity | Ubiquitous with high expression in cervix, spleen and brain. Expressed in hematopoietic cells with increased expression in leukemia cells. Isoform 2 is highly expressed in spleen with almost no expression in muscle and brain. Ref.1 Ref.9 Ref.10 |
| Sequence similarities | Belongs to the mask family. Contains 25 ANK repeats. Contains 1 KH domain. |
| Sequence caution | The sequence BAA91417.1 differs from that shown. Reason: Erroneous initiation. The sequence BAB13958.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | ANK repeat Coiled coil Repeat |
| Ligand | RNA-binding |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | cytoplasm Inferred from direct assay. Source: HPA nucleusInferred from direct assay. Source: HPA |
| Molecular function | RNA binding Inferred from electronic annotation. Source: UniProtKB-KW protein bindingInferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| DISC1 | Q9NRI5 | 6 | EBI-1785446,EBI-529989 |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8IWZ3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8IWZ3-2) Also known as: VBARP-L; The sequence of this isoform differs from the canonical sequence as follows: 595-627: EHESEGGRTPLMKAARAGHLCTVQFLISKGANV → DKQEDMKTILEGIDPAKHQVRVAFDACKLLRKE 628-2542: Missing. | ||||||
| Isoform 3 (identifier: Q8IWZ3-3) The sequence of this isoform differs from the canonical sequence as follows: 154-164: Missing. 595-627: EHESEGGRTPLMKAARAGHLCTVQFLISKGANV → DKQEDMKTILEGIDPAKHQVRVAFDACKLLRKE 628-2542: Missing. | ||||||
| Isoform 4 (identifier: Q8IWZ3-4) The sequence of this isoform differs from the canonical sequence as follows: 2342-2343: SS → SCDSPIPSVSSGSSSPLSA 2524-2542: IWPGTWAPHIGNMHLKYVN → VKWA | ||||||
| Isoform 5 (identifier: Q8IWZ3-5) The sequence of this isoform differs from the canonical sequence as follows: 559-581: ANVHATTATGDTALTYACENGHT → QAGGHEDYFGGHRSGQASGEGGL 582-2542: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 2542 | 2542 | Ankyrin repeat and KH domain-containing protein 1 | PRO_0000306326 | |||||
Regions | |||||||||
| Repeat | 204 – 233 | 30 | ANK 1 | ||||||
| Repeat | 237 – 266 | 30 | ANK 2 | ||||||
| Repeat | 271 – 300 | 30 | ANK 3 | ||||||
| Repeat | 304 – 333 | 30 | ANK 4 | ||||||
| Repeat | 337 – 366 | 30 | ANK 5 | ||||||
| Repeat | 371 – 400 | 30 | ANK 6 | ||||||
| Repeat | 404 – 433 | 30 | ANK 7 | ||||||
| Repeat | 437 – 466 | 30 | ANK 8 | ||||||
| Repeat | 470 – 499 | 30 | ANK 9 | ||||||
| Repeat | 504 – 533 | 30 | ANK 10 | ||||||
| Repeat | 534 – 563 | 30 | ANK 11 | ||||||
| Repeat | 567 – 596 | 30 | ANK 12 | ||||||
| Repeat | 600 – 629 | 30 | ANK 13 | ||||||
| Repeat | 634 – 663 | 30 | ANK 14 | ||||||
| Repeat | 667 – 696 | 30 | ANK 15 | ||||||
| Repeat | 1054 – 1083 | 30 | ANK 16 | ||||||
| Repeat | 1087 – 1116 | 30 | ANK 17 | ||||||
| Repeat | 1121 – 1150 | 30 | ANK 18 | ||||||
| Repeat | 1154 – 1183 | 30 | ANK 19 | ||||||
| Repeat | 1189 – 1218 | 30 | ANK 20 | ||||||
| Repeat | 1223 – 1252 | 30 | ANK 21 | ||||||
| Repeat | 1256 – 1285 | 30 | ANK 22 | ||||||
| Repeat | 1291 – 1320 | 30 | ANK 23 | ||||||
| Repeat | 1324 – 1353 | 30 | ANK 24 | ||||||
| Repeat | 1357 – 1386 | 30 | ANK 25 | ||||||
| Domain | 1695 – 1759 | 65 | KH | ||||||
| Coiled coil | 775 – 852 | 78 | Potential | ||||||
| Coiled coil | 1415 – 1485 | 71 | Potential | ||||||
| Compositional bias | 6 – 94 | 89 | Gly-rich | ||||||
| Compositional bias | 1977 – 2100 | 124 | Ser-rich | ||||||
| Compositional bias | 2291 – 2299 | 9 | Poly-Ser | ||||||
Amino acid modifications | |||||||||
| Modified residue | 101 | 1 | Phosphoserine Ref.13 | ||||||
| Modified residue | 1653 | 1 | Phosphothreonine Ref.11 | ||||||
| Modified residue | 1670 | 1 | Phosphoserine Ref.12 Ref.13 | ||||||
| Modified residue | 1679 | 1 | Phosphoserine Ref.12 | ||||||
Natural variations | |||||||||
| Alternative sequence | 154 – 164 | 11 | Missing in isoform 3. | VSP_028452 | |||||
| Alternative sequence | 559 – 581 | 23 | ANVHA…ENGHT → QAGGHEDYFGGHRSGQASGE GGL in isoform 5. | VSP_028453 | |||||
| Alternative sequence | 582 – 2542 | 1961 | Missing in isoform 5. | VSP_028454 | |||||
| Alternative sequence | 595 – 627 | 33 | EHESE…KGANV → DKQEDMKTILEGIDPAKHQV RVAFDACKLLRKE in isoform 2 and isoform 3. | VSP_028455 | |||||
| Alternative sequence | 628 – 2542 | 1915 | Missing in isoform 2 and isoform 3. | VSP_028456 | |||||
| Alternative sequence | 2342 – 2343 | 2 | SS → SCDSPIPSVSSGSSSPLSA in isoform 4. | VSP_028457 | |||||
| Alternative sequence | 2524 – 2542 | 19 | IWPGT…LKYVN → VKWA in isoform 4. | VSP_028458 | |||||
| Natural variant | 175 | 1 | L → M. Ref.5 Corresponds to variant rs17850570 [ dbSNP | Ensembl ]. | VAR_035291 | |||||
| Natural variant | 228 | 1 | G → C. Ref.5 Corresponds to variant rs17850572 [ dbSNP | Ensembl ]. | VAR_035292 | |||||
| Natural variant | 1586 | 1 | G → S. Corresponds to variant rs1051309 [ dbSNP | Ensembl ]. | VAR_048281 | |||||
| Natural variant | 1760 | 1 | N → S. Corresponds to variant rs3752704 [ dbSNP | Ensembl ]. | VAR_035293 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Gene fusion and overlapping reading frames in the mammalian genes for 4E-BP3 and MASK." Poulin F., Brueschke A., Sonenberg N. J. Biol. Chem. 278:52290-52297(2003) [PubMed: 14557257] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. |
| [2] | "Large-scale cDNA transfection screening for genes related to cancer development and progression." Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X. Gu J.Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed: 15498874] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [3] | "The DNA sequence and comparative analysis of human chromosome 5." Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. Rubin E.M.Nature 431:268-274(2004) [PubMed: 15372022] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 5), VARIANTS MET-175 AND CYS-228. Tissue: Lung. |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 670-1189 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 105-2542 (ISOFORM 2). Tissue: Embryo. |
| [7] | "A novel protein with ten ankyrin repeats." Cheng C.M., Yuo C.Y. Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 924-1455 (ISOFORM 1). |
| [8] | "Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Kikuno R., Nagase T., Ishikawa K., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 6:197-205(1999) [PubMed: 10470851] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1961-2542 (ISOFORM 4). Tissue: Brain. |
| [9] | "Molecular and functional characterization of a novel splice variant of ANKHD1 that lacks the KH domain and its role in cell survival and apoptosis." Miles M.C., Janket M.L., Wheeler E.D., Chattopadhyay A., Majumder B., Dericco J., Schafer E.A., Ayyavoo V. FEBS J. 272:4091-4102(2005) [PubMed: 16098192] [Abstract] Cited for: INTERACTION WITH HIV-1 VPR, FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [10] | "ANKHD1, ankyrin repeat and KH domain containing 1, is overexpressed in acute leukemias and is associated with SHP2 in K562 cells." Traina F., Favaro P.M.B., Medina Sde S., Duarte Ada S., Winnischofer S.M., Costa F.F., Saad S.T.O. Biochim. Biophys. Acta 1762:828-834(2006) [PubMed: 16956752] [Abstract] Cited for: TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INTERACTION WITH PTPN11. |
| [11] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-1653, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1670 AND SER-1679, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [13] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-101 AND SER-1670, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [14] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF521882 mRNA. Translation: AAO14943.1. AF258557 mRNA. Translation: AAG23760.1. AC008438 Genomic DNA. No translation available. AC011399 Genomic DNA. No translation available. CH471062 Genomic DNA. Translation: EAW62058.1. BC004457 mRNA. Translation: AAH04457.2. BC009420 mRNA. Translation: AAH09420.1. BC009909 mRNA. Translation: AAH09909.1. BC117677 mRNA. Translation: AAI17678.1. BC117678 mRNA. Translation: AAI17679.1. BC127127 mRNA. Translation: AAI27128.1. BC150486 mRNA. Translation: AAI50487.1. AK000904 mRNA. Translation: BAA91417.1. Different initiation. AK022041 mRNA. Translation: BAB13958.1. Different initiation. AF217646 mRNA. Translation: AAG41779.1. AB029008 mRNA. Translation: BAA83037.1. |
| IPI | IPI00410680. IPI00556571. IPI00797397. IPI00871927. IPI01013411. |
| RefSeq | NP_001183959.1. NM_001197030.1. NP_060217.1. NM_017747.2. NP_060448.1. NM_017978.2. NP_078944.2. NM_024668.3. |
| UniGene | Hs.594084. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1N11 based on UniProtKB P16157. |
| ProteinModelPortal | Q8IWZ3. |
| SMR | Q8IWZ3. Positions 168-689, 1054-1380. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-36371N. |
| IntAct | Q8IWZ3. 5 interactions. |
| MINT | MINT-1427756. |
| STRING | Q8IWZ3. |
PTM databases | |
| PhosphoSite | Q8IWZ3. |
Polymorphism databases | |
| DMDM | 74750718. |
Proteomic databases | |
| PRIDE | Q8IWZ3. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000360839; ENSP00000354085; ENSG00000131503. |
| GeneID | 54882. |
| KEGG | hsa:54882. |
| UCSC | uc003lfo.1. human. uc003lfp.1. human. uc003lfr.1. human. uc010jfk.1. human. |
Organism-specific databases | |
| CTD | 54882. |
| GeneCards | GC05P139763. |
| HGNC | HGNC:24714. ANKHD1. |
| HPA | HPA008718. |
| MIM | 610500. gene. |
| neXtProt | NX_Q8IWZ3. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | HBG071352. |
| OrthoDB | EOG4K9BB8. |
| PhylomeDB | Q8IWZ3. |
Gene expression databases | |
| ArrayExpress | Q8IWZ3. |
| Bgee | Q8IWZ3. |
| Genevestigator | Q8IWZ3. |
Family and domain databases | |
| InterPro | IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR004087. KH. IPR004088. KH_type_1. IPR018111. KH_type_1_subgr. [Graphical view] |
| Gene3D | G3DSA:1.25.40.20. ANK. 7 hits. |
| Pfam | PF00023. Ank. 2 hits. PF12796. Ank_2. 9 hits. PF00013. KH_1. 1 hit. [Graphical view] |
| PRINTS | PR01415. ANKYRIN. |
| SMART | SM00248. ANK. 25 hits. SM00322. KH. 1 hit. [Graphical view] |
| SUPFAM | SSF48403. ANK. 3 hits. |
| PROSITE | PS50297. ANK_REP_REGION. 1 hit. PS50088. ANK_REPEAT. 20 hits. PS50084. KH_TYPE_1. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 57847. |
| SOURCE | Search... |
Entry information
| Entry name | ANKH1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8IWZ3 Secondary accession number(s): A6NH85 Q9UPR7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with