Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8IWZ3

- ANKH1_HUMAN

UniProt

Q8IWZ3 - ANKH1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Ankyrin repeat and KH domain-containing protein 1

Gene

ANKHD1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May play a role as a scaffolding protein that may be associated with the abnormal phenotype of leukemia cells. Isoform 2 may possess an antiapoptotic effect and protect cells during normal cell survival through its regulation of caspases.1 Publication

GO - Molecular functioni

  1. poly(A) RNA binding Source: UniProtKB
Complete GO annotation...

Keywords - Ligandi

RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Ankyrin repeat and KH domain-containing protein 1
Alternative name(s):
HIV-1 Vpr-binding ankyrin repeat protein
Multiple ankyrin repeats single KH domain
Short name:
hMASK
Gene namesi
Name:ANKHD1
Synonyms:KIAA1085, MASK, VBARP
ORF Names:PP2500
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:24714. ANKHD1.

Subcellular locationi

Cytoplasm 2 Publications

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134947858.
PA162376432.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 25422542Ankyrin repeat and KH domain-containing protein 1PRO_0000306326Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionine1 Publication
Modified residuei101 – 1011Phosphoserine1 Publication
Modified residuei1653 – 16531Phosphothreonine1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ8IWZ3.
PaxDbiQ8IWZ3.
PRIDEiQ8IWZ3.

PTM databases

PhosphoSiteiQ8IWZ3.

Expressioni

Tissue specificityi

Ubiquitous with high expression in cervix, spleen and brain. Expressed in hematopoietic cells with increased expression in leukemia cells. Isoform 2 is highly expressed in spleen with almost no expression in muscle and brain.3 Publications

Gene expression databases

BgeeiQ8IWZ3.
ExpressionAtlasiQ8IWZ3. baseline and differential.
GenevestigatoriQ8IWZ3.

Organism-specific databases

HPAiHPA008718.

Interactioni

Subunit structurei

Interacts with PTPN11. Isoform 2 interacts with HIV-1 VPR.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
DISC1Q9NRI56EBI-1785446,EBI-529989
NFKBIEO002212EBI-359558,EBI-355098

Protein-protein interaction databases

BioGridi120230. 18 interactions.
DIPiDIP-36371N.
IntActiQ8IWZ3. 12 interactions.
MINTiMINT-1427756.

Structurei

3D structure databases

ProteinModelPortaliQ8IWZ3.
SMRiQ8IWZ3. Positions 185-726, 976-1456.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati204 – 23330ANK 1Add
BLAST
Repeati237 – 26630ANK 2Add
BLAST
Repeati271 – 30030ANK 3Add
BLAST
Repeati304 – 33330ANK 4Add
BLAST
Repeati337 – 36630ANK 5Add
BLAST
Repeati371 – 40030ANK 6Add
BLAST
Repeati404 – 43330ANK 7Add
BLAST
Repeati437 – 46630ANK 8Add
BLAST
Repeati470 – 49930ANK 9Add
BLAST
Repeati504 – 53330ANK 10Add
BLAST
Repeati534 – 56330ANK 11Add
BLAST
Repeati567 – 59630ANK 12Add
BLAST
Repeati600 – 62930ANK 13Add
BLAST
Repeati634 – 66330ANK 14Add
BLAST
Repeati667 – 69630ANK 15Add
BLAST
Repeati1054 – 108330ANK 16Add
BLAST
Repeati1087 – 111630ANK 17Add
BLAST
Repeati1121 – 115030ANK 18Add
BLAST
Repeati1154 – 118330ANK 19Add
BLAST
Repeati1189 – 121830ANK 20Add
BLAST
Repeati1223 – 125230ANK 21Add
BLAST
Repeati1256 – 128530ANK 22Add
BLAST
Repeati1291 – 132030ANK 23Add
BLAST
Repeati1324 – 135330ANK 24Add
BLAST
Repeati1357 – 138630ANK 25Add
BLAST
Domaini1695 – 175965KHPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili775 – 85278Sequence AnalysisAdd
BLAST
Coiled coili1415 – 148571Sequence AnalysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi6 – 9489Gly-richAdd
BLAST
Compositional biasi1977 – 2100124Ser-richAdd
BLAST
Compositional biasi2291 – 22999Poly-Ser

Sequence similaritiesi

Belongs to the mask family.Curated
Contains 25 ANK repeats.PROSITE-ProRule annotation
Contains 1 KH domain.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Coiled coil, Repeat

Phylogenomic databases

eggNOGiCOG0666.
GeneTreeiENSGT00760000118867.
HOVERGENiHBG071352.
InParanoidiQ8IWZ3.
KOiK16726.
OMAiKVSGNHQ.
PhylomeDBiQ8IWZ3.
TreeFamiTF328552.

Family and domain databases

Gene3Di1.25.40.20. 3 hits.
3.30.1370.10. 1 hit.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR004087. KH_dom.
IPR004088. KH_dom_type_1.
[Graphical view]
PfamiPF00023. Ank. 1 hit.
PF12796. Ank_2. 8 hits.
PF00013. KH_1. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 25 hits.
SM00322. KH. 1 hit.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 3 hits.
SSF54791. SSF54791. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 20 hits.
PS50084. KH_TYPE_1. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8IWZ3-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLTDSGGGGT SFEEDLDSVA PRSAPAGASE PPPPGGVGLG IRTVRLFGEA
60 70 80 90 100
GPASGVGSSG GGGSGSGTGG GDAALDFKLA AAVLRTGGGG GASGSDEDEV
110 120 130 140 150
SEVESFILDQ EDLDNPVLKT TSEIFLSSTA EGADLRTVDP ETQARLEALL
160 170 180 190 200
EAAGIGKLST ADGKAFADPE VLRRLTSSVS CALDEAAAAL TRMKAENSHN
210 220 230 240 250
AGQVDTRSLA EACSDGDVNA VRKLLDEGRS VNEHTEEGES LLCLACSAGY
260 270 280 290 300
YELAQVLLAM HANVEDRGNK GDITPLMAAS SGGYLDIVKL LLLHDADVNS
310 320 330 340 350
QSATGNTALT YACAGGFVDI VKVLLNEGAN IEDHNENGHT PLMEAASAGH
360 370 380 390 400
VEVARVLLDH GAGINTHSNE FKESALTLAC YKGHLDMVRF LLEAGADQEH
410 420 430 440 450
KTDEMHTALM EACMDGHVEV ARLLLDSGAQ VNMPADSFES PLTLAACGGH
460 470 480 490 500
VELAALLIER GANLEEVNDE GYTPLMEAAR EGHEEMVALL LAQGANINAQ
510 520 530 540 550
TEETQETALT LACCGGFSEV ADFLIKAGAD IELGCSTPLM EASQEGHLEL
560 570 580 590 600
VKYLLASGAN VHATTATGDT ALTYACENGH TDVADVLLQA GADLEHESEG
610 620 630 640 650
GRTPLMKAAR AGHLCTVQFL ISKGANVNRA TANNDHTVVS LACAGGHLAV
660 670 680 690 700
VELLLAHGAD PTHRLKDGST MLIEAAKGGH TNVVSYLLDY PNNVLSVPTT
710 720 730 740 750
DVSQLPPPSQ DQSQVPRVPT HTLAMVVPPQ EPDRTSQENS PALLGVQKGT
760 770 780 790 800
SKQKSSSLQV ADQDLLPSFH PYQPLECIVE ETEGKLNELG QRISAIEKAQ
810 820 830 840 850
LKSLELIQGE PLNKDKIEEL KKNREEQVQK KKKILKELQK VERQLQMKTQ
860 870 880 890 900
QQFTKEYLET KGQKDTVSLH QQCSHRGVFP EGEGDGSLPE DHFSELPQVD
910 920 930 940 950
TILFKDNDVD DEQQSPPSAE QIDFVPVQPL SSPQCNFSSD LGSNGTNSLE
960 970 980 990 1000
LQKVSGNQQI VGQPQIAITG HDQGLLVQEP DGLMVATPAQ TLTDTLDDLI
1010 1020 1030 1040 1050
AAVSTRVPTG SNSSSQTTEC LTPESCSQTT SNVASQSMPP VYPSVDIDAH
1060 1070 1080 1090 1100
TESNHDTALT LACAGGHEEL VSVLIARDAK IEHRDKKGFT PLILAATAGH
1110 1120 1130 1140 1150
VGVVEILLDK GGDIEAQSER TKDTPLSLAC SGGRQEVVDL LLARGANKEH
1160 1170 1180 1190 1200
RNVSDYTPLS LAASGGYVNI IKILLNAGAE INSRTGSKLG ISPLMLAAMN
1210 1220 1230 1240 1250
GHVPAVKLLL DMGSDINAQI ETNRNTALTL ACFQGRAEVV SLLLDRKANV
1260 1270 1280 1290 1300
EHRAKTGLTP LMEAASGGYA EVGRVLLDKG ADVNAPPVPS SRDTALTIAA
1310 1320 1330 1340 1350
DKGHYKFCEL LIHRGAHIDV RNKKGNTPLW LASNGGHFDV VQLLVQAGAD
1360 1370 1380 1390 1400
VDAADNRKIT PLMSAFRKGH VKVVQYLVKE VNQFPSDIEC MRYIATITDK
1410 1420 1430 1440 1450
ELLKKCHQCV ETIVKAKDQQ AAEANKNASI LLKELDLEKS REESRKQALA
1460 1470 1480 1490 1500
AKREKRKEKR KKKKEEQKRK QEEDEENKPK ENSELPEDED EEENDEDVEQ
1510 1520 1530 1540 1550
EVPIEPPSAT TTTTIGISAT SATFTNVFGK KRANVVTTPS TNRKNKKNKT
1560 1570 1580 1590 1600
KETPPTAHLI LPEQHMSLAQ QKADKNKING EPRGGGAGGN SDSDNLDSTD
1610 1620 1630 1640 1650
CNSESSSGGK SQELNFVMDV NSSKYPSLLL HSQEEKTSTA TSKTQTRLEG
1660 1670 1680 1690 1700
EVTPNSLSTS YKTVSLPLSS PNIKLNLTSP KRGQKREEGW KEVVRRSKKL
1710 1720 1730 1740 1750
SVPASVVSRI MGRGGCNITA IQDVTGAHID VDKQKDKNGE RMITIRGGTE
1760 1770 1780 1790 1800
STRYAVQLIN ALIQDPAKEL EDLIPKNHIR TPASTKSIHA NFSSGVGTTA
1810 1820 1830 1840 1850
ASSKNAFPLG APTLVTSQAT TLSTFQPANK LNKNVPTNVR SSFPVSLPLA
1860 1870 1880 1890 1900
YPHPHFALLA AQTMQQIRHP RLPMAQFGGT FSPSPNTWGP FPVRPVNPGN
1910 1920 1930 1940 1950
TNSSPKHNNT SRLPNQNGTV LPSESAGLAT ASCPITVSSV VAASQQLCVT
1960 1970 1980 1990 2000
NTRTPSSVRK QLFACVPKTS PPATVISSVT STCSSLPSVS SAPITSGQAP
2010 2020 2030 2040 2050
TTFLPASTSQ AQLSSQKMES FSAVPPTKEK VSTQDQPMAN LCTPSSTANS
2060 2070 2080 2090 2100
CSSSASNTPG APETHPSSSP TPTSSNTQEE AQPSSVSDLS PMSMPFASNS
2110 2120 2130 2140 2150
EPAPLTLTSP RMVAADNQDT SNLPQLAVPA PRVSHRMQPR GSFYSMVPNA
2160 2170 2180 2190 2200
TIHQDPQSIF VTNPVTLTPP QGPPAAVQLS SAVNIMNGSQ MHINPANKSL
2210 2220 2230 2240 2250
PPTFGPATLF NHFSSLFDSS QVPANQGWGD GPLSSRVATD ASFTVQSAFL
2260 2270 2280 2290 2300
GNSVLGHLEN MHPDNSKAPG FRPPSQRVST SPVGLPSIDP SGSSPSSSSA
2310 2320 2330 2340 2350
PLASFSGIPG TRVFLQGPAP VGTPSFNRQH FSPHPWTSAS NSSTSAPPTL
2360 2370 2380 2390 2400
GQPKGVSASQ DRKIPPPIGT ERLARIRQGG SVAQAPAGTS FVAPVGHSGI
2410 2420 2430 2440 2450
WSFGVNAVSE GLSGWSQSVM GNHPMHQQLS DPSTFSQHQP MERDDSGMVA
2460 2470 2480 2490 2500
PSNIFHQPMA SGFVDFSKGL PISMYGGTII PSHPQLADVP GGPLFNGLHN
2510 2520 2530 2540
PDPAWNPMIK VIQNSTECTD AQQIWPGTWA PHIGNMHLKY VN
Length:2,542
Mass (Da):269,458
Last modified:March 1, 2003 - v1
Checksum:iAB310E826A4134D0
GO
Isoform 2 (identifier: Q8IWZ3-2) [UniParc]FASTAAdd to Basket

Also known as: VBARP-L

The sequence of this isoform differs from the canonical sequence as follows:
     595-627: EHESEGGRTPLMKAARAGHLCTVQFLISKGANV → DKQEDMKTILEGIDPAKHQVRVAFDACKLLRKE
     628-2542: Missing.

Show »
Length:627
Mass (Da):64,912
Checksum:i141288C8EC9A42CB
GO
Isoform 3 (identifier: Q8IWZ3-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-164: Missing.
     595-627: EHESEGGRTPLMKAARAGHLCTVQFLISKGANV → DKQEDMKTILEGIDPAKHQVRVAFDACKLLRKE
     628-2542: Missing.

Show »
Length:616
Mass (Da):63,884
Checksum:i813BEFD05BB8753B
GO
Isoform 4 (identifier: Q8IWZ3-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2342-2343: SS → SCDSPIPSVSSGSSSPLSA
     2524-2542: IWPGTWAPHIGNMHLKYVN → VKWA

Show »
Length:2,544
Mass (Da):269,298
Checksum:iCF2D5BAF8FF3D40D
GO
Isoform 5 (identifier: Q8IWZ3-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     559-581: ANVHATTATGDTALTYACENGHT → QAGGHEDYFGGHRSGQASGEGGL
     582-2542: Missing.

Show »
Length:581
Mass (Da):59,777
Checksum:i1909744ED03FC919
GO
Isoform 6 (identifier: Q8IWZ3-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2524-2542: IWPGTWAPHIGNMHLKYVN → ASLLPSVPAL...GAGDRGRDTR

Show »
Length:2,617
Mass (Da):277,175
Checksum:i2C93ED2B397C7CA6
GO

Sequence cautioni

The sequence BAA91417.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB13958.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti175 – 1751L → M.1 Publication
Corresponds to variant rs17850570 [ dbSNP | Ensembl ].
VAR_035291
Natural varianti228 – 2281G → C.1 Publication
Corresponds to variant rs17850572 [ dbSNP | Ensembl ].
VAR_035292
Natural varianti1586 – 15861G → S.
Corresponds to variant rs1051309 [ dbSNP | Ensembl ].
VAR_048281
Natural varianti1760 – 17601N → S.
Corresponds to variant rs3752704 [ dbSNP | Ensembl ].
VAR_035293

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei154 – 16411Missing in isoform 3. 1 PublicationVSP_028452Add
BLAST
Alternative sequencei559 – 58123ANVHA…ENGHT → QAGGHEDYFGGHRSGQASGE GGL in isoform 5. 1 PublicationVSP_028453Add
BLAST
Alternative sequencei582 – 25421961Missing in isoform 5. 1 PublicationVSP_028454Add
BLAST
Alternative sequencei595 – 62733EHESE…KGANV → DKQEDMKTILEGIDPAKHQV RVAFDACKLLRKE in isoform 2 and isoform 3. 3 PublicationsVSP_028455Add
BLAST
Alternative sequencei628 – 25421915Missing in isoform 2 and isoform 3. 3 PublicationsVSP_028456Add
BLAST
Alternative sequencei2342 – 23432SS → SCDSPIPSVSSGSSSPLSA in isoform 4. 1 PublicationVSP_028457
Alternative sequencei2524 – 254219IWPGT…LKYVN → VKWA in isoform 4. 1 PublicationVSP_028458Add
BLAST
Alternative sequencei2524 – 254219IWPGT…LKYVN → ASLLPSVPALKGEIPSPQLT RPKKRIGRPMVASPNQRHQD HLRPKVPAGVQELTHCPDTP LLPPSDSRGHNSSNSPSLQA GGAEGAGDRGRDTR in isoform 6. 1 PublicationVSP_044231Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF521882 mRNA. Translation: AAO14943.1.
AF521883 mRNA. Translation: AAO14944.1.
AF258557 mRNA. Translation: AAG23760.1.
AC008438 Genomic DNA. No translation available.
AC011399 Genomic DNA. No translation available.
CH471062 Genomic DNA. Translation: EAW62055.1.
CH471062 Genomic DNA. Translation: EAW62058.1.
BC004457 mRNA. Translation: AAH04457.2.
BC009420 mRNA. Translation: AAH09420.1.
BC009909 mRNA. Translation: AAH09909.1.
BC117677 mRNA. Translation: AAI17678.1.
BC117678 mRNA. Translation: AAI17679.1.
BC127127 mRNA. Translation: AAI27128.1.
BC150486 mRNA. Translation: AAI50487.1.
AK000904 mRNA. Translation: BAA91417.1. Different initiation.
AK022041 mRNA. Translation: BAB13958.1. Different initiation.
AF217646 mRNA. Translation: AAG41779.1.
AB029008 mRNA. Translation: BAA83037.1.
CCDSiCCDS4225.1. [Q8IWZ3-1]
CCDS43371.1. [Q8IWZ3-2]
CCDS43372.1. [Q8IWZ3-3]
CCDS75319.1. [Q8IWZ3-5]
RefSeqiNP_001183959.1. NM_001197030.1. [Q8IWZ3-5]
NP_060217.1. NM_017747.2. [Q8IWZ3-1]
NP_060448.1. NM_017978.2. [Q8IWZ3-3]
NP_065741.3. NM_020690.5. [Q8IWZ3-6]
NP_078944.2. NM_024668.3. [Q8IWZ3-2]
UniGeneiHs.594084.

Genome annotation databases

EnsembliENST00000360839; ENSP00000354085; ENSG00000131503. [Q8IWZ3-1]
ENST00000394722; ENSP00000378211; ENSG00000131503. [Q8IWZ3-3]
ENST00000394723; ENSP00000378212; ENSG00000131503. [Q8IWZ3-2]
ENST00000616482; ENSP00000478529; ENSG00000131503. [Q8IWZ3-5]
GeneIDi404734.
54882.
KEGGihsa:404734.
hsa:54882.
UCSCiuc003lfo.3. human. [Q8IWZ3-2]
uc003lfp.3. human. [Q8IWZ3-3]
uc003lfr.3. human. [Q8IWZ3-1]
uc003lfs.2. human. [Q8IWZ3-6]
uc010jfk.3. human. [Q8IWZ3-5]

Polymorphism databases

DMDMi74750718.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF521882 mRNA. Translation: AAO14943.1 .
AF521883 mRNA. Translation: AAO14944.1 .
AF258557 mRNA. Translation: AAG23760.1 .
AC008438 Genomic DNA. No translation available.
AC011399 Genomic DNA. No translation available.
CH471062 Genomic DNA. Translation: EAW62055.1 .
CH471062 Genomic DNA. Translation: EAW62058.1 .
BC004457 mRNA. Translation: AAH04457.2 .
BC009420 mRNA. Translation: AAH09420.1 .
BC009909 mRNA. Translation: AAH09909.1 .
BC117677 mRNA. Translation: AAI17678.1 .
BC117678 mRNA. Translation: AAI17679.1 .
BC127127 mRNA. Translation: AAI27128.1 .
BC150486 mRNA. Translation: AAI50487.1 .
AK000904 mRNA. Translation: BAA91417.1 . Different initiation.
AK022041 mRNA. Translation: BAB13958.1 . Different initiation.
AF217646 mRNA. Translation: AAG41779.1 .
AB029008 mRNA. Translation: BAA83037.1 .
CCDSi CCDS4225.1. [Q8IWZ3-1 ]
CCDS43371.1. [Q8IWZ3-2 ]
CCDS43372.1. [Q8IWZ3-3 ]
CCDS75319.1. [Q8IWZ3-5 ]
RefSeqi NP_001183959.1. NM_001197030.1. [Q8IWZ3-5 ]
NP_060217.1. NM_017747.2. [Q8IWZ3-1 ]
NP_060448.1. NM_017978.2. [Q8IWZ3-3 ]
NP_065741.3. NM_020690.5. [Q8IWZ3-6 ]
NP_078944.2. NM_024668.3. [Q8IWZ3-2 ]
UniGenei Hs.594084.

3D structure databases

ProteinModelPortali Q8IWZ3.
SMRi Q8IWZ3. Positions 185-726, 976-1456.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120230. 18 interactions.
DIPi DIP-36371N.
IntActi Q8IWZ3. 12 interactions.
MINTi MINT-1427756.

PTM databases

PhosphoSitei Q8IWZ3.

Polymorphism databases

DMDMi 74750718.

Proteomic databases

MaxQBi Q8IWZ3.
PaxDbi Q8IWZ3.
PRIDEi Q8IWZ3.

Protocols and materials databases

DNASUi 54882.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000360839 ; ENSP00000354085 ; ENSG00000131503 . [Q8IWZ3-1 ]
ENST00000394722 ; ENSP00000378211 ; ENSG00000131503 . [Q8IWZ3-3 ]
ENST00000394723 ; ENSP00000378212 ; ENSG00000131503 . [Q8IWZ3-2 ]
ENST00000616482 ; ENSP00000478529 ; ENSG00000131503 . [Q8IWZ3-5 ]
GeneIDi 404734.
54882.
KEGGi hsa:404734.
hsa:54882.
UCSCi uc003lfo.3. human. [Q8IWZ3-2 ]
uc003lfp.3. human. [Q8IWZ3-3 ]
uc003lfr.3. human. [Q8IWZ3-1 ]
uc003lfs.2. human. [Q8IWZ3-6 ]
uc010jfk.3. human. [Q8IWZ3-5 ]

Organism-specific databases

CTDi 404734.
54882.
GeneCardsi GC05P139781.
HGNCi HGNC:24714. ANKHD1.
HPAi HPA008718.
MIMi 610500. gene.
neXtProti NX_Q8IWZ3.
PharmGKBi PA134947858.
PA162376432.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0666.
GeneTreei ENSGT00760000118867.
HOVERGENi HBG071352.
InParanoidi Q8IWZ3.
KOi K16726.
OMAi KVSGNHQ.
PhylomeDBi Q8IWZ3.
TreeFami TF328552.

Miscellaneous databases

ChiTaRSi ANKHD1. human.
GeneWikii ANKHD1.
NextBioi 107909.
PROi Q8IWZ3.
SOURCEi Search...

Gene expression databases

Bgeei Q8IWZ3.
ExpressionAtlasi Q8IWZ3. baseline and differential.
Genevestigatori Q8IWZ3.

Family and domain databases

Gene3Di 1.25.40.20. 3 hits.
3.30.1370.10. 1 hit.
InterProi IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR004087. KH_dom.
IPR004088. KH_dom_type_1.
[Graphical view ]
Pfami PF00023. Ank. 1 hit.
PF12796. Ank_2. 8 hits.
PF00013. KH_1. 1 hit.
[Graphical view ]
PRINTSi PR01415. ANKYRIN.
SMARTi SM00248. ANK. 25 hits.
SM00322. KH. 1 hit.
[Graphical view ]
SUPFAMi SSF48403. SSF48403. 3 hits.
SSF54791. SSF54791. 1 hit.
PROSITEi PS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 20 hits.
PS50084. KH_TYPE_1. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Gene fusion and overlapping reading frames in the mammalian genes for 4E-BP3 and MASK."
    Poulin F., Brueschke A., Sonenberg N.
    J. Biol. Chem. 278:52290-52297(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 6), TISSUE SPECIFICITY.
  2. "Large-scale cDNA transfection screening for genes related to cancer development and progression."
    Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X.
    , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
    Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  3. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 5), VARIANTS MET-175 AND CYS-228.
    Tissue: Lung.
  6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 670-1189 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 105-2542 (ISOFORM 2).
    Tissue: Embryo.
  7. "A novel protein with ten ankyrin repeats."
    Cheng C.M., Yuo C.Y.
    Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 924-1455 (ISOFORM 1).
  8. "Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Kikuno R., Nagase T., Ishikawa K., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 6:197-205(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1961-2542 (ISOFORM 4).
    Tissue: Brain.
  9. "Molecular and functional characterization of a novel splice variant of ANKHD1 that lacks the KH domain and its role in cell survival and apoptosis."
    Miles M.C., Janket M.L., Wheeler E.D., Chattopadhyay A., Majumder B., Dericco J., Schafer E.A., Ayyavoo V.
    FEBS J. 272:4091-4102(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH HIV-1 VPR, FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  10. "ANKHD1, ankyrin repeat and KH domain containing 1, is overexpressed in acute leukemias and is associated with SHP2 in K562 cells."
    Traina F., Favaro P.M.B., Medina Sde S., Duarte Ada S., Winnischofer S.M., Costa F.F., Saad S.T.O.
    Biochim. Biophys. Acta 1762:828-834(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INTERACTION WITH PTPN11.
  11. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
    Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
    Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-1653, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  13. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  14. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-101, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  15. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  16. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  17. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiANKH1_HUMAN
AccessioniPrimary (citable) accession number: Q8IWZ3
Secondary accession number(s): A6NH85
, Q149P2, Q8IWZ2, Q8WY90, Q96G77, Q96GK0, Q9H2U0, Q9HA95, Q9NWG4, Q9UPR7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: March 1, 2003
Last modified: October 29, 2014
This is version 108 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3