Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

E3 ubiquitin-protein ligase UBR2

Gene

UBR2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. Plays a critical role in chromatin inactivation and chromosome-wide transcriptional silencing during meiosis via ubiquitination of histone H2A. Binds leucine and is a negative regulator of the leucine-mTOR signaling pathway, thereby controlling cell growth.3 Publications

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri97 – 168UBR-typePROSITE-ProRule annotationAdd BLAST72
Zinc fingeri1108 – 1214RING-type; atypicalAdd BLAST107

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Ubl conjugation pathway

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.
SIGNORiQ8IWV8.
UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
E3 ubiquitin-protein ligase UBR2 (EC:6.3.2.-)
Alternative name(s):
N-recognin-2
Ubiquitin-protein ligase E3-alpha-2
Ubiquitin-protein ligase E3-alpha-II
Gene namesi
Name:UBR2
Synonyms:C6orf133, KIAA0349
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:21289. UBR2.

Subcellular locationi

  • Nucleus By similarity

  • Note: Associated with chromatin during meiosis.

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi23304.
OpenTargetsiENSG00000024048.
PharmGKBiPA128394621.

Polymorphism and mutation databases

BioMutaiUBR2.
DMDMi73622073.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00000561402 – 1755E3 ubiquitin-protein ligase UBR2Add BLAST1754

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ8IWV8.
MaxQBiQ8IWV8.
PaxDbiQ8IWV8.
PeptideAtlasiQ8IWV8.
PRIDEiQ8IWV8.

PTM databases

iPTMnetiQ8IWV8.
PhosphoSitePlusiQ8IWV8.

Expressioni

Tissue specificityi

Broadly expressed, with highest levels in skeletal muscle, kidney and pancreas. Present in acinar cells of the pancreas (at protein level).2 Publications

Developmental stagei

Expressed in fetal pancreas.1 Publication

Gene expression databases

BgeeiENSG00000024048.
CleanExiHS_UBR2.
GenevisibleiQ8IWV8. HS.

Organism-specific databases

HPAiHPA027869.
HPA027880.

Interactioni

Subunit structurei

Interacts with UBE2B; promotes the UBE2B-H2A interaction and the ubiquitination of histone H2A by UBE2B and UBR2 (By similarity). Interacts with RECQL4.By similarity2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
vifP125043EBI-1237260,EBI-779991From a different organism.

Protein-protein interaction databases

BioGridi116896. 63 interactors.
DIPiDIP-38165N.
IntActiQ8IWV8. 16 interactors.
STRINGi9606.ENSP00000361990.

Structurei

Secondary structure

11755
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi108 – 112Combined sources5
Turni113 – 115Combined sources3
Beta strandi116 – 118Combined sources3
Helixi125 – 129Combined sources5
Helixi132 – 135Combined sources4
Beta strandi138 – 142Combined sources5
Turni154 – 156Combined sources3
Beta strandi157 – 159Combined sources3
Turni164 – 166Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3NY2X-ray2.61A/B/C/D/E/F/G/H98-167[»]
3NY3X-ray1.60A98-167[»]
ProteinModelPortaliQ8IWV8.
SMRiQ8IWV8.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8IWV8.

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili1019 – 1054Sequence analysisAdd BLAST36

Domaini

The RING-H2 zinc finger is an atypical RING finger with a His ligand in place of the fourth Cys of the classical motif.
The UBR-type zinc finger forms a pocket that mediates recognition of type 1 N-degrons. It exhibits preference for Arginine in first position, has poor affinity for histidine, and doesn't bind acetylated peptides.

Sequence similaritiesi

Belongs to the UBR1 family.Curated
Contains 1 RING-type zinc finger.Curated
Contains 1 UBR-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri97 – 168UBR-typePROSITE-ProRule annotationAdd BLAST72
Zinc fingeri1108 – 1214RING-type; atypicalAdd BLAST107

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

eggNOGiKOG1140. Eukaryota.
ENOG410XPQU. LUCA.
GeneTreeiENSGT00530000063055.
HOGENOMiHOG000231769.
HOVERGENiHBG080426.
InParanoidiQ8IWV8.
KOiK10626.
OMAiANCLVYD.
OrthoDBiEOG091G009K.
PhylomeDBiQ8IWV8.
TreeFamiTF323875.

Family and domain databases

Gene3Di3.30.1390.10. 1 hit.
3.30.40.10. 2 hits.
InterProiIPR003769. ClpS_core.
IPR014719. Ribosomal_L7/12_C/ClpS-like.
IPR011991. WHTH_DNA-bd_dom.
IPR013083. Znf_RING/FYVE/PHD.
IPR003126. Znf_UBR.
[Graphical view]
PfamiPF02617. ClpS. 1 hit.
PF02207. zf-UBR. 1 hit.
[Graphical view]
SMARTiSM00396. ZnF_UBR1. 1 hit.
[Graphical view]
SUPFAMiSSF46785. SSF46785. 1 hit.
SSF54736. SSF54736. 1 hit.
PROSITEiPS51157. ZF_UBR. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8IWV8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASELEPEVQ AIDRSLLECS AEEIAGKWLQ ATDLTREVYQ HLAHYVPKIY
60 70 80 90 100
CRGPNPFPQK EDMLAQHVLL GPMEWYLCGE DPAFGFPKLE QANKPSHLCG
110 120 130 140 150
RVFKVGEPTY SCRDCAVDPT CVLCMECFLG SIHRDHRYRM TTSGGGGFCD
160 170 180 190 200
CGDTEAWKEG PYCQKHELNT SEIEEEEDPL VHLSEDVIAR TYNIFAITFR
210 220 230 240 250
YAVEILTWEK ESELPADLEM VEKSDTYYCM LFNDEVHTYE QVIYTLQKAV
260 270 280 290 300
NCTQKEAIGF ATTVDRDGRR SVRYGDFQYC EQAKSVIVRN TSRQTKPLKV
310 320 330 340 350
QVMHSSIVAH QNFGLKLLSW LGSIIGYSDG LRRILCQVGL QEGPDGENSS
360 370 380 390 400
LVDRLMLSDS KLWKGARSVY HQLFMSSLLM DLKYKKLFAV RFAKNYQQLQ
410 420 430 440 450
RDFMEDDHER AVSVTALSVQ FFTAPTLARM LITEENLMSI IIKTFMDHLR
460 470 480 490 500
HRDAQGRFQF ERYTALQAFK FRRVQSLILD LKYVLISKPT EWSDELRQKF
510 520 530 540 550
LEGFDAFLEL LKCMQGMDPI TRQVGQHIEM EPEWEAAFTL QMKLTHVISM
560 570 580 590 600
MQDWCASDEK VLIEAYKKCL AVLMQCHGGY TDGEQPITLS ICGHSVETIR
610 620 630 640 650
YCVSQEKVSI HLPVSRLLAG LHVLLSKSEV AYKFPELLPL SELSPPMLIE
660 670 680 690 700
HPLRCLVLCA QVHAGMWRRN GFSLVNQIYY YHNVKCRREM FDKDVVMLQT
710 720 730 740 750
GVSMMDPNHF LMIMLSRFEL YQIFSTPDYG KRFSSEITHK DVVQQNNTLI
760 770 780 790 800
EEMLYLIIML VGERFSPGVG QVNATDEIKR EIIHQLSIKP MAHSELVKSL
810 820 830 840 850
PEDENKETGM ESVIEAVAHF KKPGLTGRGM YELKPECAKE FNLYFYHFSR
860 870 880 890 900
AEQSKAEEAQ RKLKRQNRED TALPPPVLPP FCPLFASLVN ILQSDVMLCI
910 920 930 940 950
MGTILQWAVE HNGYAWSESM LQRVLHLIGM ALQEEKQHLE NVTEEHVVTF
960 970 980 990 1000
TFTQKISKPG EAPKNSPSIL AMLETLQNAP YLEVHKDMIR WILKTFNAVK
1010 1020 1030 1040 1050
KMRESSPTSP VAETEGTIME ESSRDKDKAE RKRKAEIARL RREKIMAQMS
1060 1070 1080 1090 1100
EMQRHFIDEN KELFQQTLEL DASTSAVLDH SPVASDMTLT ALGPAQTQVP
1110 1120 1130 1140 1150
EQRQFVTCIL CQEEQEVKVE SRAMVLAAFV QRSTVLSKNR SKFIQDPEKY
1160 1170 1180 1190 1200
DPLFMHPDLS CGTHTSSCGH IMHAHCWQRY FDSVQAKEQR RQQRLRLHTS
1210 1220 1230 1240 1250
YDVENGEFLC PLCECLSNTV IPLLLPPRNI FNNRLNFSDQ PNLTQWIRTI
1260 1270 1280 1290 1300
SQQIKALQFL RKEESTPNNA STKNSENVDE LQLPEGFRPD FRPKIPYSES
1310 1320 1330 1340 1350
IKEMLTTFGT ATYKVGLKVH PNEEDPRVPI MCWGSCAYTI QSIERILSDE
1360 1370 1380 1390 1400
DKPLFGPLPC RLDDCLRSLT RFAAAHWTVA SVSVVQGHFC KLFASLVPND
1410 1420 1430 1440 1450
SHEELPCILD IDMFHLLVGL VLAFPALQCQ DFSGISLGTG DLHIFHLVTM
1460 1470 1480 1490 1500
AHIIQILLTS CTEENGMDQE NPPCEEESAV LALYKTLHQY TGSALKEIPS
1510 1520 1530 1540 1550
GWHLWRSVRA GIMPFLKCSA LFFHYLNGVP SPPDIQVPGT SHFEHLCSYL
1560 1570 1580 1590 1600
SLPNNLICLF QENSEIMNSL IESWCRNSEV KRYLEGERDA IRYPRESNKL
1610 1620 1630 1640 1650
INLPEDYSSL INQASNFSCP KSGGDKSRAP TLCLVCGSLL CSQSYCCQTE
1660 1670 1680 1690 1700
LEGEDVGACT AHTYSCGSGV GIFLRVRECQ VLFLAGKTKG CFYSPPYLDD
1710 1720 1730 1740 1750
YGETDQGLRR GNPLHLCKER FKKIQKLWHQ HSVTEEIGHA QEANQTLVGI

DWQHL
Length:1,755
Mass (Da):200,538
Last modified:March 1, 2003 - v1
Checksum:i04B14FCB13E21808
GO
Isoform 2 (identifier: Q8IWV8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     397-439: QQLQRDFMED...MLITEENLMS → ERLQSDYVTD...ISAGRSGSPL
     440-1755: Missing.

Show »
Length:439
Mass (Da):49,978
Checksum:iD1A9B29DF254AE1F
GO
Isoform 3 (identifier: Q8IWV8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-496: Missing.
     497-514: RQKFLEGFDAFLELLKCM → MYAGNIPIYKTESRSRNE
     1022-1071: SSRDKDKAER...ELFQQTLELD → HNFRVQGTKT...MKTKNSFSRH
     1072-1755: Missing.

Note: No experimental confirmation available.
Show »
Length:575
Mass (Da):66,052
Checksum:iEC2722AF55B26BD3
GO
Isoform 4 (identifier: Q8IWV8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     397-426: QQLQRDFMEDDHERAVSVTALSVQFFTAPT → ERLQSDYVTDDHDREFSVADLSVQIFTVPS

Note: Derived from mouse cDNA data. No experimental confirmation available.
Show »
Length:1,755
Mass (Da):200,540
Checksum:i6FE8C7C600C162EE
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti864K → R in BAC86295 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_052117172E → D.Corresponds to variant rs6905054dbSNPEnsembl.1
Natural variantiVAR_0598161095A → P.Corresponds to variant rs6917033dbSNPEnsembl.1
Natural variantiVAR_0598171095A → S.Corresponds to variant rs6917033dbSNPEnsembl.1
Natural variantiVAR_0232831095A → T.1 PublicationCorresponds to variant rs6917033dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0151661 – 496Missing in isoform 3. 1 PublicationAdd BLAST496
Alternative sequenceiVSP_015167397 – 439QQLQR…ENLMS → ERLQSDYVTDDHDREFSVAD LSVQIFTVPSLFSISAGRSG SPL in isoform 2. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_017130397 – 426QQLQR…FTAPT → ERLQSDYVTDDHDREFSVAD LSVQIFTVPS in isoform 4. CuratedAdd BLAST30
Alternative sequenceiVSP_015168440 – 1755Missing in isoform 2. 1 PublicationAdd BLAST1316
Alternative sequenceiVSP_015169497 – 514RQKFL…LLKCM → MYAGNIPIYKTESRSRNE in isoform 3. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_0151701022 – 1071SSRDK…TLELD → HNFRVQGTKTKLRGREKQRL PDCAEKRSWLRCLKCSGILL MKTKNSFSRH in isoform 3. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_0151711072 – 1755Missing in isoform 3. 1 PublicationAdd BLAST684

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY061884 mRNA. Translation: AAL32101.1.
AK125795 mRNA. Translation: BAC86295.1.
AL049843, AL136223, AL391814 Genomic DNA. Translation: CAI20399.1.
AL049843, AL136223, AL391814 Genomic DNA. Translation: CAI95685.1.
AL136223, AL391814 Genomic DNA. Translation: CAI19919.1.
AL136223, AL049843, AL391814 Genomic DNA. Translation: CAI19920.1.
AL136223, AL049843, AL391814 Genomic DNA. Translation: CAI95666.1.
AL391814, AL136223 Genomic DNA. Translation: CAI14737.1.
AL391814, AL136223, AL049843 Genomic DNA. Translation: CAI14738.1.
AL391814, AL049843, AL136223 Genomic DNA. Translation: CAI95298.1.
BC024217 mRNA. Translation: AAH24217.1.
BC064512 mRNA. Translation: AAH64512.1.
AB002347 mRNA. Translation: BAA20806.1.
CCDSiCCDS4870.1. [Q8IWV8-1]
CCDS55001.1. [Q8IWV8-2]
RefSeqiNP_001171730.1. NM_001184801.1. [Q8IWV8-2]
NP_056070.1. NM_015255.2. [Q8IWV8-1]
XP_005249022.1. XM_005248965.4. [Q8IWV8-4]
UniGeneiHs.529925.

Genome annotation databases

EnsembliENST00000372899; ENSP00000361990; ENSG00000024048. [Q8IWV8-1]
ENST00000372901; ENSP00000361992; ENSG00000024048. [Q8IWV8-4]
ENST00000372903; ENSP00000361994; ENSG00000024048. [Q8IWV8-2]
GeneIDi23304.
KEGGihsa:23304.
UCSCiuc003osf.4. human. [Q8IWV8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY061884 mRNA. Translation: AAL32101.1.
AK125795 mRNA. Translation: BAC86295.1.
AL049843, AL136223, AL391814 Genomic DNA. Translation: CAI20399.1.
AL049843, AL136223, AL391814 Genomic DNA. Translation: CAI95685.1.
AL136223, AL391814 Genomic DNA. Translation: CAI19919.1.
AL136223, AL049843, AL391814 Genomic DNA. Translation: CAI19920.1.
AL136223, AL049843, AL391814 Genomic DNA. Translation: CAI95666.1.
AL391814, AL136223 Genomic DNA. Translation: CAI14737.1.
AL391814, AL136223, AL049843 Genomic DNA. Translation: CAI14738.1.
AL391814, AL049843, AL136223 Genomic DNA. Translation: CAI95298.1.
BC024217 mRNA. Translation: AAH24217.1.
BC064512 mRNA. Translation: AAH64512.1.
AB002347 mRNA. Translation: BAA20806.1.
CCDSiCCDS4870.1. [Q8IWV8-1]
CCDS55001.1. [Q8IWV8-2]
RefSeqiNP_001171730.1. NM_001184801.1. [Q8IWV8-2]
NP_056070.1. NM_015255.2. [Q8IWV8-1]
XP_005249022.1. XM_005248965.4. [Q8IWV8-4]
UniGeneiHs.529925.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3NY2X-ray2.61A/B/C/D/E/F/G/H98-167[»]
3NY3X-ray1.60A98-167[»]
ProteinModelPortaliQ8IWV8.
SMRiQ8IWV8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116896. 63 interactors.
DIPiDIP-38165N.
IntActiQ8IWV8. 16 interactors.
STRINGi9606.ENSP00000361990.

PTM databases

iPTMnetiQ8IWV8.
PhosphoSitePlusiQ8IWV8.

Polymorphism and mutation databases

BioMutaiUBR2.
DMDMi73622073.

Proteomic databases

EPDiQ8IWV8.
MaxQBiQ8IWV8.
PaxDbiQ8IWV8.
PeptideAtlasiQ8IWV8.
PRIDEiQ8IWV8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372899; ENSP00000361990; ENSG00000024048. [Q8IWV8-1]
ENST00000372901; ENSP00000361992; ENSG00000024048. [Q8IWV8-4]
ENST00000372903; ENSP00000361994; ENSG00000024048. [Q8IWV8-2]
GeneIDi23304.
KEGGihsa:23304.
UCSCiuc003osf.4. human. [Q8IWV8-1]

Organism-specific databases

CTDi23304.
DisGeNETi23304.
GeneCardsiUBR2.
HGNCiHGNC:21289. UBR2.
HPAiHPA027869.
HPA027880.
MIMi609134. gene.
neXtProtiNX_Q8IWV8.
OpenTargetsiENSG00000024048.
PharmGKBiPA128394621.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1140. Eukaryota.
ENOG410XPQU. LUCA.
GeneTreeiENSGT00530000063055.
HOGENOMiHOG000231769.
HOVERGENiHBG080426.
InParanoidiQ8IWV8.
KOiK10626.
OMAiANCLVYD.
OrthoDBiEOG091G009K.
PhylomeDBiQ8IWV8.
TreeFamiTF323875.

Enzyme and pathway databases

UniPathwayiUPA00143.
ReactomeiR-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.
SIGNORiQ8IWV8.

Miscellaneous databases

ChiTaRSiUBR2. human.
EvolutionaryTraceiQ8IWV8.
GeneWikiiUBR2.
GenomeRNAii23304.
PROiQ8IWV8.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000024048.
CleanExiHS_UBR2.
GenevisibleiQ8IWV8. HS.

Family and domain databases

Gene3Di3.30.1390.10. 1 hit.
3.30.40.10. 2 hits.
InterProiIPR003769. ClpS_core.
IPR014719. Ribosomal_L7/12_C/ClpS-like.
IPR011991. WHTH_DNA-bd_dom.
IPR013083. Znf_RING/FYVE/PHD.
IPR003126. Znf_UBR.
[Graphical view]
PfamiPF02617. ClpS. 1 hit.
PF02207. zf-UBR. 1 hit.
[Graphical view]
SMARTiSM00396. ZnF_UBR1. 1 hit.
[Graphical view]
SUPFAMiSSF46785. SSF46785. 1 hit.
SSF54736. SSF54736. 1 hit.
PROSITEiPS51157. ZF_UBR. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiUBR2_HUMAN
AccessioniPrimary (citable) accession number: Q8IWV8
Secondary accession number(s): O15057
, Q4VXK2, Q5TFH6, Q6P2I2, Q6ZUD0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: March 1, 2003
Last modified: November 30, 2016
This is version 136 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.