Q8IWS0 (PHF6_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 98.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: PHD finger protein 6 Alternative name(s): PHD-like zinc finger protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 365 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play a role in transcriptional regulation. |
| Subcellular location | Nucleus. Nucleus › nucleolus. Note: Nuclear, it particularly localizes to the nucleolus. Ref.1 |
| Tissue specificity | Ubiquitously expressed. Ref.1 |
| Involvement in disease | Boerjeson-Forssman-Lehmann syndrome (BFLS) [MIM:301900]: A X-linked recessive disorder characterized by moderate to severe mental retardation, epilepsy, hypogonadism, hypometabolism, obesity with marked gynecomastia, swelling of subcutaneous tissue of the face, narrow palpebral fissure and large but not deformed ears. |
| Sequence similarities | Contains 2 PHD-type zinc fingers. |
| Sequence caution | The sequence BAB47452.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Disease | Disease mutation Epilepsy Mental retardation |
| Domain | Repeat Zinc-finger |
| Ligand | Metal-binding Zinc |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | regulation of transcription, DNA-dependent Inferred from electronic annotation. Source: UniProtKB-KW transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | nucleolus Inferred from direct assay. Source: HPA |
| Molecular_function | zinc ion binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8IWS0-1) Also known as: PHF6a; PHF6b; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8IWS0-2) The sequence of this isoform differs from the canonical sequence as follows: 140-140: A → AA 279-311: KCTLCSQPGATIGCEIKACVKTYHYHCGVQDKA → VCSFYICYATLHLICCFKFRVHPKFIQSSENLK 312-365: Missing. | ||||||
| Note: No experimental confirmation available. Contains a phosphoserine at position 146. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 365 | 365 | PHD finger protein 6 | PRO_0000059293 | |||||
Regions | |||||||||
| Zinc finger | 79 – 131 | 53 | PHD-type 1; degenerate | ||||||
| Zinc finger | 277 – 329 | 53 | PHD-type 2; degenerate | ||||||
| Motif | 13 – 16 | 4 | Nuclear localization signal Potential | ||||||
| Motif | 129 – 133 | 5 | Nuclear localization signal Potential | ||||||
| Motif | 157 – 169 | 13 | Nucleolar localization signal Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 138 | 1 | Phosphoserine Ref.9 Ref.10 | ||||||
| Modified residue | 145 | 1 | Phosphoserine Ref.9 Ref.11 | ||||||
| Modified residue | 155 | 1 | Phosphoserine Ref.13 | ||||||
| Modified residue | 199 | 1 | Phosphoserine Ref.13 | ||||||
| Modified residue | 358 | 1 | Phosphothreonine Ref.7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 140 | 1 | A → AA in isoform 2. | VSP_009372 | |||||
| Alternative sequence | 279 – 311 | 33 | KCTLC…VQDKA → VCSFYICYATLHLICCFKFR VHPKFIQSSENLK in isoform 2. | VSP_009373 | |||||
| Alternative sequence | 312 – 365 | 54 | Missing in isoform 2. | VSP_009374 | |||||
| Natural variant | 45 | 1 | C → Y in BFLS. Ref.1 Corresponds to variant rs28935179 [ dbSNP | Ensembl ]. | VAR_017633 | |||||
| Natural variant | 99 | 1 | C → F in BFLS. Ref.1 | VAR_017634 | |||||
| Natural variant | 229 | 1 | H → R in BFLS. Ref.1 | VAR_017635 | |||||
| Natural variant | 234 | 1 | K → E in BFLS. Ref.1 | VAR_017636 | |||||
| Natural variant | 257 | 1 | R → G in BFLS. Ref.1 | VAR_017637 | |||||
Experimental info | |||||||||
| Sequence conflict | 126 | 1 | V → A in AAH05994. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Mutations in PHF6 are associated with Boerjeson-Forssman-Lehmann syndrome." Lower K.M., Turner G., Kerr B.A., Mathews K.D., Shaw M.A., Gedeon A.K., Schelley S., Hoyme H.E., White S.M., Delatycki M.B., Lampe A.K., Clayton-Smith J., Stewart H., van Ravenswaay C.M.A., de Vries B.B.A., Cox B., Grompe M., Ross S. Gecz J.Nat. Genet. 32:661-665(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, ALTERNATIVE SPLICING, VARIANTS BFLS TYR-45; PHE-99; ARG-229; GLU-234 AND GLY-257. |
| [2] | "Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O. DNA Res. 8:85-95(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [3] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Bone marrow. |
| [6] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [7] | "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J. Science 316:1160-1166(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-358, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [8] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-138 AND SER-145, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-146 (ISOFORM 2), MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-138, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [11] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-145, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [13] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-155 AND SER-199, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY157622 mRNA. Translation: AAO13214.1. AB058726 mRNA. Translation: BAB47452.1. Different initiation. AL591668, AC004383 Genomic DNA. Translation: CAI41600.1. AL591668 Genomic DNA. Translation: CAI41601.1. CH471107 Genomic DNA. Translation: EAX11762.1. CH471107 Genomic DNA. Translation: EAX11763.1. CH471107 Genomic DNA. Translation: EAX11766.1. BC005994 mRNA. Translation: AAH05994.1. |
| IPI | IPI00395568. IPI00397700. |
| RefSeq | NP_001015877.1. NM_001015877.1. NP_115711.2. NM_032335.3. NP_115834.1. NM_032458.2. |
| UniGene | Hs.356501. |
3D structure databases | |
| ProteinModelPortal | Q8IWS0. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8IWS0. 2 interactions. |
| STRING | 9606.ENSP00000329097. |
PTM databases | |
| PhosphoSite | Q8IWS0. |
Polymorphism databases | |
| DMDM | 42559482. |
Proteomic databases | |
| PaxDb | Q8IWS0. |
| PeptideAtlas | Q8IWS0. |
| PRIDE | Q8IWS0. |
Protocols and materials databases | |
| DNASU | 84295. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000332070; ENSP00000329097; ENSG00000156531. ENST00000370800; ENSP00000359836; ENSG00000156531. ENST00000370803; ENSP00000359839; ENSG00000156531. |
| GeneID | 84295. |
| KEGG | hsa:84295. |
| UCSC | uc004exh.3. human. uc004exj.3. human. |
Organism-specific databases | |
| CTD | 84295. |
| GeneCards | GC0XP133507. |
| HGNC | HGNC:18145. PHF6. |
| HPA | HPA001023. |
| MIM | 300414. gene. 301900. phenotype. |
| neXtProt | NX_Q8IWS0. |
| Orphanet | 127. Borjeson-Forssman-Lehmann syndrome. |
| PharmGKB | PA33263. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG282606. |
| HOGENOM | HOG000026798. |
| HOVERGEN | HBG049389. |
| OrthoDB | EOG4K9BCK. |
| PhylomeDB | Q8IWS0. |
Gene expression databases | |
| ArrayExpress | Q8IWS0. |
| Bgee | Q8IWS0. |
| CleanEx | HS_PHF6. |
| Genevestigator | Q8IWS0. |
| GermOnline | ENSG00000156531. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001965. Znf_PHD. [Graphical view] |
| SMART | SM00249. PHD. 2 hits. [Graphical view] |
| PROSITE | PS01359. ZF_PHD_1. False negative. PS50016. ZF_PHD_2. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | PHF6. human. |
| GenomeRNAi | 84295. |
| NextBio | 73944. |
| SOURCE | Search... |
Entry information
| Entry name | PHF6_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8IWS0 Secondary accession number(s): D3DTG3 Q9BRU0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
