Q8IWQ3 (BRSK2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 110.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Serine/threonine-protein kinase BRSK2 EC=2.7.11.1 Alternative name(s): Brain-selective kinase 2 EC=2.7.11.26 Brain-specific serine/threonine-protein kinase 2 Short name=BR serine/threonine-protein kinase 2 Serine/threonine-protein kinase 29 Serine/threonine-protein kinase SAD-A | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 736 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Serine/threonine-protein kinase that plays a key role in polarization of neurons and axonogenesis, cell cycle progress and insulin secretion. Phosphorylates CDK16, CDC25C, MAPT/TAU, PAK1 and WEE1. Following phosphorylation and activation by STK11/LKB1, acts as a key regulator of polarization of cortical neurons, probably by mediating phosphorylation of microtubule-associated proteins such as MAPT/TAU at 'Thr-529' and 'Ser-579'. Also regulates neuron polarization by mediating phosphorylation of WEE1 at 'Ser-642' in post-mitotic neurons, leading to down-regulate WEE1 activity in polarized neurons. Plays a role in the regulation of the mitotic cell cycle progress and the onset of mitosis. Plays a role in the regulation of insulin secretion in response to elevated glucose levels, probably via phosphorylation of CDK16 and PAK1. While BRSK2 phosphorylated at Thr-174 can inhibit insulin secretion (Ref.18), BRSK2 phosphorylated at Thr-260 can promote insulin secretion (Ref.17). Regulates reorganization of the actin cytoskeleton. May play a role in the apoptotic response triggered by endoplasmatic reticulum (ER) stress. Ref.8 Ref.14 Ref.17 Ref.18 Ref.19 Ref.20 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. Ref.18 Ref.19 ATP + [tau protein] = ADP + [tau protein] phosphate. Ref.18 Ref.19 |
| Cofactor | Magnesium By similarity. |
| Enzyme regulation | Activated by phosphorylation on Thr-174 by STK11/LKB1. Ref.8 |
| Subunit structure | Interacts with FZR1, a regulatory subunit of the APC ubiquitin ligase complex. Interacts with COPS5. Interacts with PAK1. Ref.15 Ref.17 Ref.20 |
| Subcellular location | Cytoplasm › cytoskeleton › centrosome. Cytoplasm › perinuclear region. Endoplasmic reticulum. Note: Detected at centrosomes during mitosis. Localizes to the endoplasmic reticulum in response to stress caused by tunicamycin. Ref.15 Ref.16 Ref.20 |
| Tissue specificity | Detected in pancreas islets (at protein level). Ref.18 |
| Domain | The KEN box motif is required for interaction with FZR1/CDH1 and essential for APC(CDH1)-mediated ubiquitination. |
| Post-translational modification | Phosphorylated at Thr-174 by STK11/LKB1 in complex with STE20-related adapter-alpha (STRADA) pseudo kinase and CAB39. Not phosphorylated at Thr-174 by CaMKK2. In contrast, it is phosphorylated and activated by CaMKK1. May be inactivated via dephosphorylation of Thr-174 by PP2C. Phosphorylated at Thr-260 by PKA. Phosphorylation at Thr-260 by PKA was not observed in another study (Ref.10), but this may reflect differences in the experimental approach. Phosphorylation at Thr-260 seems to play a role in the regulation of insulin secretion (Ref.17). Ref.8 Ref.9 Ref.10 Ref.13 Polyubiquitinated by the APC complex in conjunction with FZR1, leading to its proteasomal degradation. Targeted for proteasomal degradation by interaction with COPS5. BRSK2 levels change during the cell cycle. BRSK2 levels are low at the G1/S boundary and gradually increase as cells progress into G2 phase. BRSK2 levels decrease rapidly at the end of mitosis. |
| Sequence similarities | Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. SNF1 subfamily. Contains 1 protein kinase domain. Contains 1 UBA domain. |
| Sequence caution | The sequence AAD09654.1 differs from that shown. Reason: Erroneous termination at position 663. Translated as Gly. The sequence AAD09654.1 differs from that shown. Reason: Frameshift at position 640. The sequence AAH24291.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8IWQ3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8IWQ3-2) The sequence of this isoform differs from the canonical sequence as follows: 647-674: DTTNCMEMMTGRLSKCGSPLSNFFDVIK → EPPPPAPGLSWGAGLKGQKVATSYESSL 675-736: Missing. | ||||||
| Isoform 3 (identifier: Q8IWQ3-3) The sequence of this isoform differs from the canonical sequence as follows: 664-668: SPLSN → IIPKS 669-736: Missing. | ||||||
| Isoform 4 (identifier: Q8IWQ3-4) The sequence of this isoform differs from the canonical sequence as follows: 408-408: Q → QSKAMFSKSLDIAEAHPQFSKED 647-674: DTTNCMEMMTGRLSKCGSPLSNFFDVIK → EPPPPAPGLSWGAGLKGQKVATSYESSL 675-736: Missing. | ||||||
| Note: Contains a phosphoserine at position 416. | ||||||
| Isoform 5 (identifier: Q8IWQ3-5) The sequence of this isoform differs from the canonical sequence as follows: 1-30: MTSTGKDGGAQHAQYVGPYRLEKTLGKGQT → MSPEGHPSRW...TWLCLQPSPA 663-678: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 736 | 736 | Serine/threonine-protein kinase BRSK2 | PRO_0000085670 | |||||
Regions | |||||||||
| Domain | 19 – 270 | 252 | Protein kinase | ||||||
| Domain | 297 – 339 | 43 | UBA | ||||||
| Nucleotide binding | 25 – 33 | 9 | ATP By similarity | ||||||
| Motif | 603 – 605 | 3 | KEN box | ||||||
| Compositional bias | 424 – 468 | 45 | Pro-rich | ||||||
Sites | |||||||||
| Active site | 141 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 48 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 174 | 1 | Phosphothreonine; by LKB1 Ref.8 Ref.10 | ||||||
| Modified residue | 260 | 1 | Phosphothreonine; by PKA Ref.9 | ||||||
| Modified residue | 367 | 1 | Phosphoserine Ref.11 | ||||||
| Modified residue | 382 | 1 | Phosphoserine Ref.11 Ref.12 | ||||||
| Modified residue | 393 | 1 | Phosphoserine Ref.11 Ref.12 | ||||||
| Modified residue | 412 | 1 | Phosphoserine Ref.12 | ||||||
| Modified residue | 422 | 1 | Phosphothreonine | ||||||
| Modified residue | 509 | 1 | Phosphothreonine Ref.12 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 30 | 30 | MTSTG…GKGQT → MSPEGHPSRWARPRRPCICP SSLCSPREPRSGPAVGRGGA AHHRVPAGHTPGPQLLQPHL HLPQGQTWLCLQPSPA in isoform 5. | VSP_022603 | |||||
| Alternative sequence | 408 | 1 | Q → QSKAMFSKSLDIAEAHPQFS KED in isoform 4. | VSP_013945 | |||||
| Alternative sequence | 647 – 674 | 28 | DTTNC…FDVIK → EPPPPAPGLSWGAGLKGQKV ATSYESSL in isoform 2 and isoform 4. | VSP_008154 | |||||
| Alternative sequence | 663 – 678 | 16 | Missing in isoform 5. | VSP_022604 | |||||
| Alternative sequence | 664 – 668 | 5 | SPLSN → IIPKS in isoform 3. | VSP_008156 | |||||
| Alternative sequence | 669 – 736 | 68 | Missing in isoform 3. | VSP_008157 | |||||
| Alternative sequence | 675 – 736 | 62 | Missing in isoform 2 and isoform 4. | VSP_008155 | |||||
Experimental info | |||||||||
| Mutagenesis | 48 | 1 | K → M: Loss of catalytic activity. Causes disintegration of actin stress fibers. Ref.17 Ref.18 | ||||||
| Mutagenesis | 174 | 1 | T → A: Prevents phosphorylation and activation by STK11/LKB1 complex. Ref.8 Ref.10 Ref.18 | ||||||
| Mutagenesis | 174 | 1 | T → E: Constitutively activated. Ref.8 Ref.10 Ref.18 | ||||||
| Mutagenesis | 260 | 1 | T → A: Decreased phosphorylation. Nearly abolishes stimulation of insulin secretion. Ref.9 Ref.17 | ||||||
| Mutagenesis | 310 | 1 | G → A: Decreased activation of kinase activity. Ref.10 | ||||||
| Mutagenesis | 443 | 1 | T → A: Constitutively activated. Promotes formation of actin stress fibers. Ref.17 | ||||||
| Sequence conflict | 251 | 1 | I → S in AAP97723. Ref.2 | ||||||
| Sequence conflict | 251 | 1 | I → S in AAP97724. Ref.2 | ||||||
| Sequence conflict | 251 | 1 | I → S in AAP97725. Ref.2 | ||||||
| Sequence conflict | 251 | 1 | I → S in AAP97726. Ref.2 | ||||||
| Sequence conflict | 251 | 1 | I → S in AAP97727. Ref.2 | ||||||
| Sequence conflict | 251 | 1 | I → S in AAN87839. Ref.2 | ||||||
| Sequence conflict | 251 | 1 | I → S in CAA07196. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "SAD: a presynaptic kinase associated with synaptic vesicles and the active zone cytomatrix that regulates neurotransmitter release." Inoue E., Mochida S., Takagi H., Higa S., Deguchi-Tawarada M., Takao-Rikitsu E., Inoue M., Yao I., Takeuchi K., Kitajima I., Setou M., Ohtsuka T., Takai Y. Neuron 50:261-275(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). |
| [2] | Guo J.H., Yu L. Submitted (AUG-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Brain. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5). Tissue: Amygdala. |
| [4] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "Characterization of 16 novel human genes showing high similarity to yeast sequences." Stanchi F., Bertocco E., Toppo S., Dioguardi R., Simionati B., Cannata N., Zimbello R., Lanfranchi G., Valle G. Yeast 18:69-80(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 72-736 (ISOFORM 2). Tissue: Brain. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 454-736 (ISOFORM 2). Tissue: Eye. |
| [7] | "Repeat-directed isolation of a novel gene preferentially expressed from the maternal allele in human placenta." Miura K., Miyoshi O., Yun K., Inazawa J., Miyamoto T., Hayashi H., Masuzaki H., Yoshimura S., Niikawa N., Jinno Y., Ishimaru T. J. Hum. Genet. 44:1-9(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 463-736 (ISOFORM 3). |
| [8] | "LKB1 is a master kinase that activates 13 kinases of the AMPK subfamily, including MARK/PAR-1." Lizcano J.M., Goeransson O., Toth R., Deak M., Morrice N.A., Boudeau J., Hawley S.A., Udd L., Maekelae T.P., Hardie D.G., Alessi D.R. EMBO J. 23:833-843(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, ENZYME REGULATION, PHOSPHORYLATION AT THR-174, MUTAGENESIS OF THR-174. |
| [9] | "BRSK2 is activated by cyclic AMP-dependent protein kinase A through phosphorylation at Thr260." Guo Z., Tang W., Yuan J., Chen X., Wan B., Gu X., Luo K., Wang Y., Yu L. Biochem. Biophys. Res. Commun. 347:867-871(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT THR-260, MUTAGENESIS OF THR-260. |
| [10] | "Investigating the regulation of brain-specific kinases 1 and 2 by phosphorylation." Bright N.J., Carling D., Thornton C. J. Biol. Chem. 283:14946-14954(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT THR-174, MUTAGENESIS OF THR-174 AND GLY-310. |
| [11] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-367; SER-382 AND SER-393, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-416 (ISOFORM 4), MASS SPECTROMETRY. |
| [12] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-382; SER-393; SER-412 AND THR-509, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [13] | "Calmodulin-dependent protein kinase kinase-beta activates AMPK without forming a stable complex: synergistic effects of Ca2+ and AMP." Fogarty S., Hawley S.A., Green K.A., Saner N., Mustard K.J., Hardie D.G. Biochem. J. 426:109-118(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION. |
| [14] | "Persistence of the cell-cycle checkpoint kinase Wee1 in SadA- and SadB-deficient neurons disrupts neuronal polarity." Muller M., Lutter D., Puschel A.W. J. Cell Sci. 123:286-294(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [15] | "Jab1 interacts with brain-specific kinase 2 (BRSK2) and promotes its degradation in the ubiquitin-proteasome pathway." Zhou J., Wan B., Li R., Gu X., Zhong Z., Wang Y., Yu L. Biochem. Biophys. Res. Commun. 422:647-652(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH COPS5, SUBCELLULAR LOCATION, UBIQUITINATION. |
| [16] | "BRSK2 is regulated by ER stress in protein level and involved in ER stress-induced apoptosis." Wang Y., Wan B., Li D., Zhou J., Li R., Bai M., Chen F., Yu L. Biochem. Biophys. Res. Commun. 423:813-818(2012) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [17] | "Synapses of amphids defective (SAD-A) kinase promotes glucose-stimulated insulin secretion through activation of p21-activated kinase (PAK1) in pancreatic beta-Cells." Nie J., Sun C., Faruque O., Ye G., Li J., Liang Q., Chang Z., Yang W., Han X., Shi Y. J. Biol. Chem. 287:26435-26444(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH PAK1, MUTAGENESIS OF LYS-48; THR-260 AND THR-443. |
| [18] | "Brain-selective kinase 2 (BRSK2) phosphorylation on PCTAIRE1 negatively regulates glucose-stimulated insulin secretion in pancreatic beta-cells." Chen X.Y., Gu X.T., Saiyin H., Wan B., Zhang Y.J., Li J., Wang Y.L., Gao R., Wang Y.F., Dong W.P., Najjar S.M., Zhang C.Y., Ding H.F., Liu J.O., Yu L. J. Biol. Chem. 287:30368-30375(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, CATALYTIC ACTIVITY, TISSUE SPECIFICITY, MUTAGENESIS OF LYS-48 AND THR-174. |
| [19] | "Phosphorylation of microtubule-associated protein tau by AMPK-related kinases." Yoshida H., Goedert M. J. Neurochem. 120:165-176(2012) [PubMed] [Europe PMC] [Abstract] Cited for: CATALYTIC ACTIVITY, FUNCTION IN MAPT PHOSPHORYLATION. |
| [20] | "APC/C(Cdh1) targets brain-specific kinase 2 (BRSK2) for degradation via the ubiquitin-proteasome pathway." Li R., Wan B., Zhou J., Wang Y., Luo T., Gu X., Chen F., Yu L. PLoS ONE 7:E45932-E45932(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, UBIQUITINATION, INTERACTION WITH FZR1, KEN BOX MOTIF. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY505125 mRNA. Translation: AAS86443.1. AF533876 mRNA. Translation: AAP97723.1. AF533877 mRNA. Translation: AAP97724.1. AF533878 mRNA. Translation: AAP97725.1. AF533879 mRNA. Translation: AAP97726.1. AF533880 mRNA. Translation: AAP97727.1. AY166857 mRNA. Translation: AAN87839.1. AK131534 mRNA. Translation: BAD18671.1. AC091196 Genomic DNA. No translation available. AC136297 Genomic DNA. No translation available. AJ006701 mRNA. Translation: CAA07196.1. BC024291 mRNA. Translation: AAH24291.1. Different initiation. AF020089 mRNA. Translation: AAD09654.1. Sequence problems. |
| IPI | IPI00028344. IPI00339265. IPI00339266. IPI00604667. IPI00744296. |
| RefSeq | NP_001243556.1. NM_001256627.1. NP_001243558.1. NM_001256629.1. NP_001243559.1. NM_001256630.1. NP_003948.2. NM_003957.3. |
| UniGene | Hs.170819. |
3D structure databases | |
| ProteinModelPortal | Q8IWQ3. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8IWQ3. 1 interaction. |
| STRING | 9606.ENSP00000310697. |
PTM databases | |
| PhosphoSite | Q8IWQ3. |
Polymorphism databases | |
| DMDM | 116241272. |
Proteomic databases | |
| PaxDb | Q8IWQ3. |
| PRIDE | Q8IWQ3. |
Protocols and materials databases | |
| DNASU | 9024. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000308219; ENSP00000310697; ENSG00000174672. ENST00000308230; ENSP00000310805; ENSG00000174672. ENST00000382179; ENSP00000371614; ENSG00000174672. ENST00000526678; ENSP00000433370; ENSG00000174672. ENST00000528841; ENSP00000432000; ENSG00000174672. ENST00000529433; ENSP00000433684; ENSG00000174672. ENST00000531197; ENSP00000431152; ENSG00000174672. |
| GeneID | 9024. |
| KEGG | hsa:9024. |
| UCSC | uc001lth.1. human. uc001lti.3. human. uc001ltj.3. human. uc001ltm.3. human. uc009ycv.1. human. |
Organism-specific databases | |
| CTD | 9024. |
| GeneCards | GC11P001368. |
| H-InvDB | HIX0009361. |
| HGNC | HGNC:11405. BRSK2. |
| MIM | 609236. gene. |
| neXtProt | NX_Q8IWQ3. |
| PharmGKB | PA36212. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0515. |
| HOGENOM | HOG000246447. |
| HOVERGEN | HBG007240. |
| InParanoid | Q8IWQ3. |
| KO | K08796. |
| OMA | ASSINMI. |
| PhylomeDB | Q8IWQ3. |
Gene expression databases | |
| ArrayExpress | Q8IWQ3. |
| Bgee | Q8IWQ3. |
| CleanEx | HS_BRSK2. |
| Genevestigator | Q8IWQ3. |
| GermOnline | ENSG00000174672. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR008271. Ser/Thr_kinase_AS. [Graphical view] |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. PS50030. UBA. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | Q8IWQ3. |
| ChEMBL | CHEMBL4574. |
| GenomeRNAi | 9024. |
| NextBio | 33809. |
| SOURCE | Search... |
Entry information
| Entry name | BRSK2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8IWQ3 Secondary accession number(s): O60843 Q8TB60 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
