Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8IWG1

- WDR63_HUMAN

UniProt

Q8IWG1 - WDR63_HUMAN

Protein

WD repeat-containing protein 63

Gene

WDR63

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 110 (01 Oct 2014)
      Sequence version 1 (01 Mar 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Enzyme and pathway databases

    SignaLinkiQ8IWG1.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    WD repeat-containing protein 63
    Alternative name(s):
    Testis development protein NYD-SP29
    Gene namesi
    Name:WDR63
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:30711. WDR63.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142670596.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 891891WD repeat-containing protein 63PRO_0000233162Add
    BLAST

    Proteomic databases

    PaxDbiQ8IWG1.
    PRIDEiQ8IWG1.

    PTM databases

    PhosphoSiteiQ8IWG1.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8IWG1.
    BgeeiQ8IWG1.
    CleanExiHS_WDR63.
    GenevestigatoriQ8IWG1.

    Organism-specific databases

    HPAiHPA038066.
    HPA038526.

    Interactioni

    Protein-protein interaction databases

    BioGridi126018. 1 interaction.
    STRINGi9606.ENSP00000294664.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8IWG1.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati395 – 43541WD 1Add
    BLAST
    Repeati477 – 53357WD 2Add
    BLAST
    Repeati670 – 70940WD 3Add
    BLAST
    Repeati713 – 75341WD 4Add
    BLAST
    Repeati761 – 80040WD 5Add
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili818 – 86144Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Contains 5 WD repeats.Curated

    Keywords - Domaini

    Coiled coil, Repeat, WD repeat

    Phylogenomic databases

    eggNOGiNOG261484.
    HOGENOMiHOG000013188.
    HOVERGENiHBG069410.
    InParanoidiQ8IWG1.
    OMAiVTCSADC.
    OrthoDBiEOG7HMS0Z.
    PhylomeDBiQ8IWG1.
    TreeFamiTF326991.

    Family and domain databases

    Gene3Di2.130.10.10. 3 hits.
    InterProiIPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR017986. WD40_repeat_dom.
    [Graphical view]
    PfamiPF00400. WD40. 1 hit.
    [Graphical view]
    SMARTiSM00320. WD40. 3 hits.
    [Graphical view]
    SUPFAMiSSF50978. SSF50978. 2 hits.
    PROSITEiPS00678. WD_REPEATS_1. 2 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8IWG1-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAPKQKKKTS RGKKRLKPVL AASEDMEPVN MESMGHPEIY PLVLTTKTQE    50
    IFNCRIDEDV TDEQPYKLIN KEDIFEDLRN RAAVSDFHPV KKIVQEYPGN 100
    ELLLVYDKDF KYGLNFYLIA TEEGKENYLN PPEVPEEQEE YKEHIPEDVY 150
    IYKPPVSKPW VSLGSEKEIE EESVTESTKQ ITYMISRKRS EFGAPIKFSD 200
    QNASSVKDAY IECTAYPDKN FTLKQLEKDV GMQVIPQIKD ISTQTKWTYP 250
    KNATTQYYPR EFSEEEKETL KQSKPLVDFL NNASISVEIA LQQNEIMNTF 300
    IDDWKYLAEE EGTFGDKTDT HLKEYQSFTD LHSPTEKMIT CVSWHPTIYG 350
    LIAVSVAVRL SFEDRVHFSG KLLLQPSLIL FWSFSDPIHP QLMLESPDDI 400
    FCFKFCPSDP NIIAGGCING QIVMWDITAH ADRIENIKAG GSRSKRATLK 450
    PMFLLEPESN KEAMYIRHCA VSSIENGHKK VITDIHWLSD TFEINRMGSV 500
    FENRSGICCQ LVTCSADCTI CFWDIRPQKP LTPQTTEKKK EESIEIPFDV 550
    PSTFLHLDLS WKPLTKVRLS KGETSLDHCP TKISLNEDHL LCKTQDKMLA 600
    QSKTEKAEEM NPYHNLESGM ANLLKPIDDF CTKFFVGTEE GEVIYTDWKM 650
    EKDPETGRLM SKKPVSHHTI HDGTVHTIQR SPFYNDIILT VGGWNVAIWK 700
    EGVMTGPLLQ SCCAPKRYTS GHWSLTRPGV FYIGREDGYI DIWDLLEKTH 750
    EPAQSQNICI TMITYIKPWI FSSKQQFIAT ADYYGTLHIL EIPWTLSRPS 800
    TNEMASVNHY FEREVKHLEY VEQRKKIREQ EKKEMELEMA KKKVKTYQKS 850
    KEQMQAELKM DYESYLELEK TVLINLGLIK VTEKGSYMEV M 891
    Length:891
    Mass (Da):102,935
    Last modified:March 1, 2003 - v1
    Checksum:i982EA7B814BCC1F1
    GO
    Isoform 2 (identifier: Q8IWG1-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         247-286: WTYPKNATTQYYPREFSEEEKETLKQSKPLVDFLNNASIS → C

    Note: No experimental confirmation available.

    Show »
    Length:852
    Mass (Da):98,301
    Checksum:iAC62D7D6F05AE2E0
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti108 – 1081K → E in AAL06239. 1 PublicationCurated
    Sequence conflicti441 – 4411G → D in AAL06239. 1 PublicationCurated
    Sequence conflicti496 – 4961R → G in AAL06239. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti674 – 6741T → A.
    Corresponds to variant rs17121745 [ dbSNP | Ensembl ].
    VAR_057630
    Natural varianti798 – 7981R → H.
    Corresponds to variant rs709783 [ dbSNP | Ensembl ].
    VAR_057631

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei247 – 28640WTYPK…NASIS → C in isoform 2. 1 PublicationVSP_018080Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY049724 mRNA. Translation: AAL06239.1.
    AK054629 mRNA. Translation: BAB70778.1.
    AK292603 mRNA. Translation: BAF85292.1.
    AL358789 Genomic DNA. Translation: CAI14916.1.
    AL358789 Genomic DNA. Translation: CAI14917.1.
    CH471097 Genomic DNA. Translation: EAW73212.1.
    BC040265 mRNA. Translation: AAH40265.1.
    CCDSiCCDS702.1. [Q8IWG1-1]
    RefSeqiNP_001275492.1. NM_001288563.1. [Q8IWG1-2]
    NP_660155.2. NM_145172.4. [Q8IWG1-1]
    UniGeneiHs.97933.

    Genome annotation databases

    EnsembliENST00000294664; ENSP00000294664; ENSG00000162643. [Q8IWG1-1]
    ENST00000326813; ENSP00000317463; ENSG00000162643. [Q8IWG1-2]
    ENST00000370596; ENSP00000359628; ENSG00000162643. [Q8IWG1-2]
    GeneIDi126820.
    KEGGihsa:126820.
    UCSCiuc001dkt.3. human. [Q8IWG1-1]
    uc009wcl.3. human. [Q8IWG1-2]

    Polymorphism databases

    DMDMi74759634.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY049724 mRNA. Translation: AAL06239.1 .
    AK054629 mRNA. Translation: BAB70778.1 .
    AK292603 mRNA. Translation: BAF85292.1 .
    AL358789 Genomic DNA. Translation: CAI14916.1 .
    AL358789 Genomic DNA. Translation: CAI14917.1 .
    CH471097 Genomic DNA. Translation: EAW73212.1 .
    BC040265 mRNA. Translation: AAH40265.1 .
    CCDSi CCDS702.1. [Q8IWG1-1 ]
    RefSeqi NP_001275492.1. NM_001288563.1. [Q8IWG1-2 ]
    NP_660155.2. NM_145172.4. [Q8IWG1-1 ]
    UniGenei Hs.97933.

    3D structure databases

    ProteinModelPortali Q8IWG1.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 126018. 1 interaction.
    STRINGi 9606.ENSP00000294664.

    PTM databases

    PhosphoSitei Q8IWG1.

    Polymorphism databases

    DMDMi 74759634.

    Proteomic databases

    PaxDbi Q8IWG1.
    PRIDEi Q8IWG1.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000294664 ; ENSP00000294664 ; ENSG00000162643 . [Q8IWG1-1 ]
    ENST00000326813 ; ENSP00000317463 ; ENSG00000162643 . [Q8IWG1-2 ]
    ENST00000370596 ; ENSP00000359628 ; ENSG00000162643 . [Q8IWG1-2 ]
    GeneIDi 126820.
    KEGGi hsa:126820.
    UCSCi uc001dkt.3. human. [Q8IWG1-1 ]
    uc009wcl.3. human. [Q8IWG1-2 ]

    Organism-specific databases

    CTDi 126820.
    GeneCardsi GC01P085464.
    HGNCi HGNC:30711. WDR63.
    HPAi HPA038066.
    HPA038526.
    neXtProti NX_Q8IWG1.
    PharmGKBi PA142670596.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG261484.
    HOGENOMi HOG000013188.
    HOVERGENi HBG069410.
    InParanoidi Q8IWG1.
    OMAi VTCSADC.
    OrthoDBi EOG7HMS0Z.
    PhylomeDBi Q8IWG1.
    TreeFami TF326991.

    Enzyme and pathway databases

    SignaLinki Q8IWG1.

    Miscellaneous databases

    GenomeRNAii 126820.
    NextBioi 81927.
    PROi Q8IWG1.

    Gene expression databases

    ArrayExpressi Q8IWG1.
    Bgeei Q8IWG1.
    CleanExi HS_WDR63.
    Genevestigatori Q8IWG1.

    Family and domain databases

    Gene3Di 2.130.10.10. 3 hits.
    InterProi IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR017986. WD40_repeat_dom.
    [Graphical view ]
    Pfami PF00400. WD40. 1 hit.
    [Graphical view ]
    SMARTi SM00320. WD40. 3 hits.
    [Graphical view ]
    SUPFAMi SSF50978. SSF50978. 2 hits.
    PROSITEi PS00678. WD_REPEATS_1. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "NYD-SP29: a new gene related to testis development."
      Sha J.H.
      Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Testis.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Astrocyte and Testis.
    3. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.

    Entry informationi

    Entry nameiWDR63_HUMAN
    AccessioniPrimary (citable) accession number: Q8IWG1
    Secondary accession number(s): A8K988, Q96L72, Q96NU4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 2, 2006
    Last sequence update: March 1, 2003
    Last modified: October 1, 2014
    This is version 110 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3