Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

WD repeat-containing protein 63

Gene

WDR63

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

Enzyme and pathway databases

SignaLinkiQ8IWG1.

Names & Taxonomyi

Protein namesi
Recommended name:
WD repeat-containing protein 63
Alternative name(s):
Testis development protein NYD-SP29
Gene namesi
Name:WDR63
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:30711. WDR63.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142670596.

Polymorphism and mutation databases

BioMutaiWDR63.
DMDMi74759634.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 891891WD repeat-containing protein 63PRO_0000233162Add
BLAST

Proteomic databases

MaxQBiQ8IWG1.
PaxDbiQ8IWG1.
PRIDEiQ8IWG1.

PTM databases

PhosphoSiteiQ8IWG1.

Expressioni

Gene expression databases

BgeeiQ8IWG1.
CleanExiHS_WDR63.
ExpressionAtlasiQ8IWG1. baseline and differential.
GenevisibleiQ8IWG1. HS.

Organism-specific databases

HPAiHPA038066.
HPA038526.

Interactioni

Protein-protein interaction databases

BioGridi126018. 1 interaction.
STRINGi9606.ENSP00000294664.

Structurei

3D structure databases

ProteinModelPortaliQ8IWG1.
SMRiQ8IWG1. Positions 377-427, 477-529, 665-745.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati395 – 43541WD 1Add
BLAST
Repeati477 – 53357WD 2Add
BLAST
Repeati670 – 70940WD 3Add
BLAST
Repeati713 – 75341WD 4Add
BLAST
Repeati761 – 80040WD 5Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili818 – 86144Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Contains 5 WD repeats.Curated

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

eggNOGiNOG261484.
GeneTreeiENSGT00740000115518.
HOGENOMiHOG000013188.
HOVERGENiHBG069410.
InParanoidiQ8IWG1.
OMAiDRVHFSG.
OrthoDBiEOG7HMS0Z.
PhylomeDBiQ8IWG1.
TreeFamiTF326991.

Family and domain databases

Gene3Di2.130.10.10. 3 hits.
InterProiIPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF00400. WD40. 1 hit.
[Graphical view]
SMARTiSM00320. WD40. 3 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 2 hits.
PROSITEiPS00678. WD_REPEATS_1. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8IWG1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPKQKKKTS RGKKRLKPVL AASEDMEPVN MESMGHPEIY PLVLTTKTQE
60 70 80 90 100
IFNCRIDEDV TDEQPYKLIN KEDIFEDLRN RAAVSDFHPV KKIVQEYPGN
110 120 130 140 150
ELLLVYDKDF KYGLNFYLIA TEEGKENYLN PPEVPEEQEE YKEHIPEDVY
160 170 180 190 200
IYKPPVSKPW VSLGSEKEIE EESVTESTKQ ITYMISRKRS EFGAPIKFSD
210 220 230 240 250
QNASSVKDAY IECTAYPDKN FTLKQLEKDV GMQVIPQIKD ISTQTKWTYP
260 270 280 290 300
KNATTQYYPR EFSEEEKETL KQSKPLVDFL NNASISVEIA LQQNEIMNTF
310 320 330 340 350
IDDWKYLAEE EGTFGDKTDT HLKEYQSFTD LHSPTEKMIT CVSWHPTIYG
360 370 380 390 400
LIAVSVAVRL SFEDRVHFSG KLLLQPSLIL FWSFSDPIHP QLMLESPDDI
410 420 430 440 450
FCFKFCPSDP NIIAGGCING QIVMWDITAH ADRIENIKAG GSRSKRATLK
460 470 480 490 500
PMFLLEPESN KEAMYIRHCA VSSIENGHKK VITDIHWLSD TFEINRMGSV
510 520 530 540 550
FENRSGICCQ LVTCSADCTI CFWDIRPQKP LTPQTTEKKK EESIEIPFDV
560 570 580 590 600
PSTFLHLDLS WKPLTKVRLS KGETSLDHCP TKISLNEDHL LCKTQDKMLA
610 620 630 640 650
QSKTEKAEEM NPYHNLESGM ANLLKPIDDF CTKFFVGTEE GEVIYTDWKM
660 670 680 690 700
EKDPETGRLM SKKPVSHHTI HDGTVHTIQR SPFYNDIILT VGGWNVAIWK
710 720 730 740 750
EGVMTGPLLQ SCCAPKRYTS GHWSLTRPGV FYIGREDGYI DIWDLLEKTH
760 770 780 790 800
EPAQSQNICI TMITYIKPWI FSSKQQFIAT ADYYGTLHIL EIPWTLSRPS
810 820 830 840 850
TNEMASVNHY FEREVKHLEY VEQRKKIREQ EKKEMELEMA KKKVKTYQKS
860 870 880 890
KEQMQAELKM DYESYLELEK TVLINLGLIK VTEKGSYMEV M
Length:891
Mass (Da):102,935
Last modified:March 1, 2003 - v1
Checksum:i982EA7B814BCC1F1
GO
Isoform 2 (identifier: Q8IWG1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     247-286: WTYPKNATTQYYPREFSEEEKETLKQSKPLVDFLNNASIS → C

Note: No experimental confirmation available.
Show »
Length:852
Mass (Da):98,301
Checksum:iAC62D7D6F05AE2E0
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti108 – 1081K → E in AAL06239 (Ref. 1) Curated
Sequence conflicti441 – 4411G → D in AAL06239 (Ref. 1) Curated
Sequence conflicti496 – 4961R → G in AAL06239 (Ref. 1) Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti674 – 6741T → A.
Corresponds to variant rs17121745 [ dbSNP | Ensembl ].
VAR_057630
Natural varianti798 – 7981R → H.
Corresponds to variant rs709783 [ dbSNP | Ensembl ].
VAR_057631

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei247 – 28640WTYPK…NASIS → C in isoform 2. 1 PublicationVSP_018080Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY049724 mRNA. Translation: AAL06239.1.
AK054629 mRNA. Translation: BAB70778.1.
AK292603 mRNA. Translation: BAF85292.1.
AL358789 Genomic DNA. Translation: CAI14916.1.
AL358789 Genomic DNA. Translation: CAI14917.1.
CH471097 Genomic DNA. Translation: EAW73212.1.
BC040265 mRNA. Translation: AAH40265.1.
CCDSiCCDS702.1. [Q8IWG1-1]
CCDS72818.1. [Q8IWG1-2]
RefSeqiNP_001275492.1. NM_001288563.1. [Q8IWG1-2]
NP_660155.2. NM_145172.4. [Q8IWG1-1]
UniGeneiHs.97933.

Genome annotation databases

EnsembliENST00000294664; ENSP00000294664; ENSG00000162643.
ENST00000326813; ENSP00000317463; ENSG00000162643. [Q8IWG1-2]
ENST00000370596; ENSP00000359628; ENSG00000162643. [Q8IWG1-2]
GeneIDi126820.
KEGGihsa:126820.
UCSCiuc001dkt.3. human. [Q8IWG1-1]
uc009wcl.3. human. [Q8IWG1-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY049724 mRNA. Translation: AAL06239.1.
AK054629 mRNA. Translation: BAB70778.1.
AK292603 mRNA. Translation: BAF85292.1.
AL358789 Genomic DNA. Translation: CAI14916.1.
AL358789 Genomic DNA. Translation: CAI14917.1.
CH471097 Genomic DNA. Translation: EAW73212.1.
BC040265 mRNA. Translation: AAH40265.1.
CCDSiCCDS702.1. [Q8IWG1-1]
CCDS72818.1. [Q8IWG1-2]
RefSeqiNP_001275492.1. NM_001288563.1. [Q8IWG1-2]
NP_660155.2. NM_145172.4. [Q8IWG1-1]
UniGeneiHs.97933.

3D structure databases

ProteinModelPortaliQ8IWG1.
SMRiQ8IWG1. Positions 377-427, 477-529, 665-745.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126018. 1 interaction.
STRINGi9606.ENSP00000294664.

PTM databases

PhosphoSiteiQ8IWG1.

Polymorphism and mutation databases

BioMutaiWDR63.
DMDMi74759634.

Proteomic databases

MaxQBiQ8IWG1.
PaxDbiQ8IWG1.
PRIDEiQ8IWG1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000294664; ENSP00000294664; ENSG00000162643.
ENST00000326813; ENSP00000317463; ENSG00000162643. [Q8IWG1-2]
ENST00000370596; ENSP00000359628; ENSG00000162643. [Q8IWG1-2]
GeneIDi126820.
KEGGihsa:126820.
UCSCiuc001dkt.3. human. [Q8IWG1-1]
uc009wcl.3. human. [Q8IWG1-2]

Organism-specific databases

CTDi126820.
GeneCardsiGC01P085464.
HGNCiHGNC:30711. WDR63.
HPAiHPA038066.
HPA038526.
neXtProtiNX_Q8IWG1.
PharmGKBiPA142670596.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG261484.
GeneTreeiENSGT00740000115518.
HOGENOMiHOG000013188.
HOVERGENiHBG069410.
InParanoidiQ8IWG1.
OMAiDRVHFSG.
OrthoDBiEOG7HMS0Z.
PhylomeDBiQ8IWG1.
TreeFamiTF326991.

Enzyme and pathway databases

SignaLinkiQ8IWG1.

Miscellaneous databases

GenomeRNAii126820.
NextBioi81927.
PROiQ8IWG1.

Gene expression databases

BgeeiQ8IWG1.
CleanExiHS_WDR63.
ExpressionAtlasiQ8IWG1. baseline and differential.
GenevisibleiQ8IWG1. HS.

Family and domain databases

Gene3Di2.130.10.10. 3 hits.
InterProiIPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF00400. WD40. 1 hit.
[Graphical view]
SMARTiSM00320. WD40. 3 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 2 hits.
PROSITEiPS00678. WD_REPEATS_1. 2 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "NYD-SP29: a new gene related to testis development."
    Sha J.H.
    Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Testis.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Astrocyte and Testis.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.

Entry informationi

Entry nameiWDR63_HUMAN
AccessioniPrimary (citable) accession number: Q8IWG1
Secondary accession number(s): A8K988, Q96L72, Q96NU4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: March 1, 2003
Last modified: July 22, 2015
This is version 117 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.