Q8IWG1 (WDR63_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 98.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: WD repeat-containing protein 63 Alternative name(s): Testis development protein NYD-SP29 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 891 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Sequence similarities | Contains 5 WD repeats. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil Repeat WD repeat |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8IWG1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8IWG1-2) The sequence of this isoform differs from the canonical sequence as follows: 247-286: WTYPKNATTQYYPREFSEEEKETLKQSKPLVDFLNNASIS → C | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 891 | 891 | WD repeat-containing protein 63 | PRO_0000233162 | |||||
Regions | |||||||||
| Repeat | 395 – 435 | 41 | WD 1 | ||||||
| Repeat | 477 – 533 | 57 | WD 2 | ||||||
| Repeat | 670 – 709 | 40 | WD 3 | ||||||
| Repeat | 713 – 753 | 41 | WD 4 | ||||||
| Repeat | 761 – 800 | 40 | WD 5 | ||||||
| Coiled coil | 818 – 861 | 44 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 247 – 286 | 40 | WTYPK…NASIS → C in isoform 2. | VSP_018080 | |||||
| Natural variant | 674 | 1 | T → A. Corresponds to variant rs17121745 [ dbSNP | Ensembl ]. | VAR_057630 | |||||
| Natural variant | 798 | 1 | R → H. Corresponds to variant rs709783 [ dbSNP | Ensembl ]. | VAR_057631 | |||||
Experimental info | |||||||||
| Sequence conflict | 108 | 1 | K → E in AAL06239. Ref.1 | ||||||
| Sequence conflict | 441 | 1 | G → D in AAL06239. Ref.1 | ||||||
| Sequence conflict | 496 | 1 | R → G in AAL06239. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "NYD-SP29: a new gene related to testis development." Sha J.H. Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Testis. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Astrocyte and Testis. |
| [3] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY049724 mRNA. Translation: AAL06239.1. AK054629 mRNA. Translation: BAB70778.1. AK292603 mRNA. Translation: BAF85292.1. AL358789 Genomic DNA. Translation: CAI14916.1. AL358789 Genomic DNA. Translation: CAI14917.1. CH471097 Genomic DNA. Translation: EAW73212.1. BC040265 mRNA. Translation: AAH40265.1. |
| IPI | IPI00293098. IPI00332144. |
| RefSeq | NP_660155.2. NM_145172.3. |
| UniGene | Hs.97933. |
3D structure databases | |
| ProteinModelPortal | Q8IWG1. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000294664. |
PTM databases | |
| PhosphoSite | Q8IWG1. |
Polymorphism databases | |
| DMDM | 74759634. |
Proteomic databases | |
| PaxDb | Q8IWG1. |
| PRIDE | Q8IWG1. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000294664; ENSP00000294664; ENSG00000162643. ENST00000326813; ENSP00000317463; ENSG00000162643. ENST00000370596; ENSP00000359628; ENSG00000162643. |
| GeneID | 126820. |
| KEGG | hsa:126820. |
| UCSC | uc001dkt.3. human. uc009wcl.3. human. |
Organism-specific databases | |
| CTD | 126820. |
| GeneCards | GC01P085464. |
| HGNC | HGNC:30711. WDR63. |
| HPA | HPA038066. |
| neXtProt | NX_Q8IWG1. |
| PharmGKB | PA142670596. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG261484. |
| HOGENOM | HOG000013188. |
| HOVERGEN | HBG069410. |
| InParanoid | Q8IWG1. |
| OMA | VAIWKEG. |
| PhylomeDB | Q8IWG1. |
Gene expression databases | |
| ArrayExpress | Q8IWG1. |
| Bgee | Q8IWG1. |
| CleanEx | HS_WDR63. |
| Genevestigator | Q8IWG1. |
| GermOnline | ENSG00000162643. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.130.10.10. 3 hits. |
| InterPro | IPR015943. WD40/YVTN_repeat-like_dom. IPR001680. WD40_repeat. IPR017986. WD40_repeat_dom. [Graphical view] |
| Pfam | PF00400. WD40. 1 hit. [Graphical view] |
| SMART | SM00320. WD40. 3 hits. [Graphical view] |
| SUPFAM | SSF50978. WD40_like. 1 hit. |
| PROSITE | PS00678. WD_REPEATS_1. 2 hits. PS50082. WD_REPEATS_2. False negative. PS50294. WD_REPEATS_REGION. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 126820. |
| NextBio | 81927. |
Entry information
| Entry name | WDR63_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8IWG1 Secondary accession number(s): A8K988, Q96L72, Q96NU4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
