Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8IWG1 (WDR63_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 106. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
WD repeat-containing protein 63
Alternative name(s):
Testis development protein NYD-SP29
Gene names
Name:WDR63
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length891 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Sequence similarities

Contains 5 WD repeats.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainCoiled coil
Repeat
WD repeat
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
None. [Check GOA]

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8IWG1-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8IWG1-2)

The sequence of this isoform differs from the canonical sequence as follows:
     247-286: WTYPKNATTQYYPREFSEEEKETLKQSKPLVDFLNNASIS → C
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 891891WD repeat-containing protein 63
PRO_0000233162

Regions

Repeat395 – 43541WD 1
Repeat477 – 53357WD 2
Repeat670 – 70940WD 3
Repeat713 – 75341WD 4
Repeat761 – 80040WD 5
Coiled coil818 – 86144 Potential

Natural variations

Alternative sequence247 – 28640WTYPK…NASIS → C in isoform 2.
VSP_018080
Natural variant6741T → A.
Corresponds to variant rs17121745 [ dbSNP | Ensembl ].
VAR_057630
Natural variant7981R → H.
Corresponds to variant rs709783 [ dbSNP | Ensembl ].
VAR_057631

Experimental info

Sequence conflict1081K → E in AAL06239. Ref.1
Sequence conflict4411G → D in AAL06239. Ref.1
Sequence conflict4961R → G in AAL06239. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 1, 2003. Version 1.
Checksum: 982EA7B814BCC1F1

FASTA891102,935
        10         20         30         40         50         60 
MAPKQKKKTS RGKKRLKPVL AASEDMEPVN MESMGHPEIY PLVLTTKTQE IFNCRIDEDV 

        70         80         90        100        110        120 
TDEQPYKLIN KEDIFEDLRN RAAVSDFHPV KKIVQEYPGN ELLLVYDKDF KYGLNFYLIA 

       130        140        150        160        170        180 
TEEGKENYLN PPEVPEEQEE YKEHIPEDVY IYKPPVSKPW VSLGSEKEIE EESVTESTKQ 

       190        200        210        220        230        240 
ITYMISRKRS EFGAPIKFSD QNASSVKDAY IECTAYPDKN FTLKQLEKDV GMQVIPQIKD 

       250        260        270        280        290        300 
ISTQTKWTYP KNATTQYYPR EFSEEEKETL KQSKPLVDFL NNASISVEIA LQQNEIMNTF 

       310        320        330        340        350        360 
IDDWKYLAEE EGTFGDKTDT HLKEYQSFTD LHSPTEKMIT CVSWHPTIYG LIAVSVAVRL 

       370        380        390        400        410        420 
SFEDRVHFSG KLLLQPSLIL FWSFSDPIHP QLMLESPDDI FCFKFCPSDP NIIAGGCING 

       430        440        450        460        470        480 
QIVMWDITAH ADRIENIKAG GSRSKRATLK PMFLLEPESN KEAMYIRHCA VSSIENGHKK 

       490        500        510        520        530        540 
VITDIHWLSD TFEINRMGSV FENRSGICCQ LVTCSADCTI CFWDIRPQKP LTPQTTEKKK 

       550        560        570        580        590        600 
EESIEIPFDV PSTFLHLDLS WKPLTKVRLS KGETSLDHCP TKISLNEDHL LCKTQDKMLA 

       610        620        630        640        650        660 
QSKTEKAEEM NPYHNLESGM ANLLKPIDDF CTKFFVGTEE GEVIYTDWKM EKDPETGRLM 

       670        680        690        700        710        720 
SKKPVSHHTI HDGTVHTIQR SPFYNDIILT VGGWNVAIWK EGVMTGPLLQ SCCAPKRYTS 

       730        740        750        760        770        780 
GHWSLTRPGV FYIGREDGYI DIWDLLEKTH EPAQSQNICI TMITYIKPWI FSSKQQFIAT 

       790        800        810        820        830        840 
ADYYGTLHIL EIPWTLSRPS TNEMASVNHY FEREVKHLEY VEQRKKIREQ EKKEMELEMA 

       850        860        870        880        890 
KKKVKTYQKS KEQMQAELKM DYESYLELEK TVLINLGLIK VTEKGSYMEV M 

« Hide

Isoform 2 [UniParc].

Checksum: AC62D7D6F05AE2E0
Show »

FASTA85298,301

References

« Hide 'large scale' references
[1]"NYD-SP29: a new gene related to testis development."
Sha J.H.
Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Testis.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Astrocyte and Testis.
[3]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY049724 mRNA. Translation: AAL06239.1.
AK054629 mRNA. Translation: BAB70778.1.
AK292603 mRNA. Translation: BAF85292.1.
AL358789 Genomic DNA. Translation: CAI14916.1.
AL358789 Genomic DNA. Translation: CAI14917.1.
CH471097 Genomic DNA. Translation: EAW73212.1.
BC040265 mRNA. Translation: AAH40265.1.
RefSeqNP_001275492.1. NM_001288563.1.
NP_660155.2. NM_145172.4.
UniGeneHs.97933.

3D structure databases

ProteinModelPortalQ8IWG1.
SMRQ8IWG1. Positions 667-745.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000294664.

PTM databases

PhosphoSiteQ8IWG1.

Polymorphism databases

DMDM74759634.

Proteomic databases

PaxDbQ8IWG1.
PRIDEQ8IWG1.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000294664; ENSP00000294664; ENSG00000162643. [Q8IWG1-1]
ENST00000326813; ENSP00000317463; ENSG00000162643. [Q8IWG1-2]
ENST00000370596; ENSP00000359628; ENSG00000162643. [Q8IWG1-2]
GeneID126820.
KEGGhsa:126820.
UCSCuc001dkt.3. human. [Q8IWG1-1]
uc009wcl.3. human. [Q8IWG1-2]

Organism-specific databases

CTD126820.
GeneCardsGC01P085464.
HGNCHGNC:30711. WDR63.
HPAHPA038066.
HPA038526.
neXtProtNX_Q8IWG1.
PharmGKBPA142670596.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG261484.
HOGENOMHOG000013188.
HOVERGENHBG069410.
InParanoidQ8IWG1.
OMAVTCSADC.
OrthoDBEOG7HMS0Z.
PhylomeDBQ8IWG1.
TreeFamTF326991.

Enzyme and pathway databases

SignaLinkQ8IWG1.

Gene expression databases

ArrayExpressQ8IWG1.
BgeeQ8IWG1.
CleanExHS_WDR63.
GenevestigatorQ8IWG1.

Family and domain databases

Gene3D2.130.10.10. 3 hits.
InterProIPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamPF00400. WD40. 1 hit.
[Graphical view]
SMARTSM00320. WD40. 3 hits.
[Graphical view]
SUPFAMSSF50978. SSF50978. 2 hits.
PROSITEPS00678. WD_REPEATS_1. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi126820.
NextBio81927.
PROQ8IWG1.

Entry information

Entry nameWDR63_HUMAN
AccessionPrimary (citable) accession number: Q8IWG1
Secondary accession number(s): A8K988, Q96L72, Q96NU4
Entry history
Integrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: March 1, 2003
Last modified: March 19, 2014
This is version 106 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM