Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

WD repeat-containing protein 63

Gene

WDR63

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

Enzyme and pathway databases

SignaLinkiQ8IWG1.

Names & Taxonomyi

Protein namesi
Recommended name:
WD repeat-containing protein 63
Alternative name(s):
Testis development protein NYD-SP29
Gene namesi
Name:WDR63
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:30711. WDR63.

Pathology & Biotechi

Organism-specific databases

DisGeNETi126820.
OpenTargetsiENSG00000162643.
PharmGKBiPA142670596.

Polymorphism and mutation databases

BioMutaiWDR63.
DMDMi74759634.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002331621 – 891WD repeat-containing protein 63Add BLAST891

Proteomic databases

MaxQBiQ8IWG1.
PaxDbiQ8IWG1.
PeptideAtlasiQ8IWG1.
PRIDEiQ8IWG1.

PTM databases

iPTMnetiQ8IWG1.
PhosphoSitePlusiQ8IWG1.

Expressioni

Gene expression databases

BgeeiENSG00000162643.
CleanExiHS_WDR63.
ExpressionAtlasiQ8IWG1. baseline and differential.
GenevisibleiQ8IWG1. HS.

Organism-specific databases

HPAiHPA038066.
HPA038526.

Interactioni

Protein-protein interaction databases

BioGridi126018. 1 interactor.
STRINGi9606.ENSP00000294664.

Structurei

3D structure databases

ProteinModelPortaliQ8IWG1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati395 – 435WD 1Add BLAST41
Repeati477 – 533WD 2Add BLAST57
Repeati670 – 709WD 3Add BLAST40
Repeati713 – 753WD 4Add BLAST41
Repeati761 – 800WD 5Add BLAST40

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili818 – 861Sequence analysisAdd BLAST44

Sequence similaritiesi

Contains 5 WD repeats.Curated

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

eggNOGiENOG410IU33. Eukaryota.
ENOG410XSJT. LUCA.
GeneTreeiENSGT00840000129862.
HOGENOMiHOG000013188.
HOVERGENiHBG069410.
InParanoidiQ8IWG1.
OMAiYGHVSRI.
OrthoDBiEOG091G01MQ.
PhylomeDBiQ8IWG1.
TreeFamiTF326991.

Family and domain databases

Gene3Di2.130.10.10. 3 hits.
InterProiIPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
SMARTiSM00320. WD40. 3 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 2 hits.
PROSITEiPS00678. WD_REPEATS_1. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8IWG1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPKQKKKTS RGKKRLKPVL AASEDMEPVN MESMGHPEIY PLVLTTKTQE
60 70 80 90 100
IFNCRIDEDV TDEQPYKLIN KEDIFEDLRN RAAVSDFHPV KKIVQEYPGN
110 120 130 140 150
ELLLVYDKDF KYGLNFYLIA TEEGKENYLN PPEVPEEQEE YKEHIPEDVY
160 170 180 190 200
IYKPPVSKPW VSLGSEKEIE EESVTESTKQ ITYMISRKRS EFGAPIKFSD
210 220 230 240 250
QNASSVKDAY IECTAYPDKN FTLKQLEKDV GMQVIPQIKD ISTQTKWTYP
260 270 280 290 300
KNATTQYYPR EFSEEEKETL KQSKPLVDFL NNASISVEIA LQQNEIMNTF
310 320 330 340 350
IDDWKYLAEE EGTFGDKTDT HLKEYQSFTD LHSPTEKMIT CVSWHPTIYG
360 370 380 390 400
LIAVSVAVRL SFEDRVHFSG KLLLQPSLIL FWSFSDPIHP QLMLESPDDI
410 420 430 440 450
FCFKFCPSDP NIIAGGCING QIVMWDITAH ADRIENIKAG GSRSKRATLK
460 470 480 490 500
PMFLLEPESN KEAMYIRHCA VSSIENGHKK VITDIHWLSD TFEINRMGSV
510 520 530 540 550
FENRSGICCQ LVTCSADCTI CFWDIRPQKP LTPQTTEKKK EESIEIPFDV
560 570 580 590 600
PSTFLHLDLS WKPLTKVRLS KGETSLDHCP TKISLNEDHL LCKTQDKMLA
610 620 630 640 650
QSKTEKAEEM NPYHNLESGM ANLLKPIDDF CTKFFVGTEE GEVIYTDWKM
660 670 680 690 700
EKDPETGRLM SKKPVSHHTI HDGTVHTIQR SPFYNDIILT VGGWNVAIWK
710 720 730 740 750
EGVMTGPLLQ SCCAPKRYTS GHWSLTRPGV FYIGREDGYI DIWDLLEKTH
760 770 780 790 800
EPAQSQNICI TMITYIKPWI FSSKQQFIAT ADYYGTLHIL EIPWTLSRPS
810 820 830 840 850
TNEMASVNHY FEREVKHLEY VEQRKKIREQ EKKEMELEMA KKKVKTYQKS
860 870 880 890
KEQMQAELKM DYESYLELEK TVLINLGLIK VTEKGSYMEV M
Length:891
Mass (Da):102,935
Last modified:March 1, 2003 - v1
Checksum:i982EA7B814BCC1F1
GO
Isoform 2 (identifier: Q8IWG1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     247-286: WTYPKNATTQYYPREFSEEEKETLKQSKPLVDFLNNASIS → C

Note: No experimental confirmation available.
Show »
Length:852
Mass (Da):98,301
Checksum:iAC62D7D6F05AE2E0
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti108K → E in AAL06239 (Ref. 1) Curated1
Sequence conflicti441G → D in AAL06239 (Ref. 1) Curated1
Sequence conflicti496R → G in AAL06239 (Ref. 1) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_057630674T → A.Corresponds to variant rs17121745dbSNPEnsembl.1
Natural variantiVAR_057631798R → H.Corresponds to variant rs709783dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_018080247 – 286WTYPK…NASIS → C in isoform 2. 1 PublicationAdd BLAST40

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY049724 mRNA. Translation: AAL06239.1.
AK054629 mRNA. Translation: BAB70778.1.
AK292603 mRNA. Translation: BAF85292.1.
AL358789 Genomic DNA. Translation: CAI14916.1.
AL358789 Genomic DNA. Translation: CAI14917.1.
CH471097 Genomic DNA. Translation: EAW73212.1.
BC040265 mRNA. Translation: AAH40265.1.
CCDSiCCDS702.1. [Q8IWG1-1]
CCDS72818.1. [Q8IWG1-2]
RefSeqiNP_001275492.1. NM_001288563.1. [Q8IWG1-2]
NP_660155.2. NM_145172.4. [Q8IWG1-1]
UniGeneiHs.97933.

Genome annotation databases

EnsembliENST00000294664; ENSP00000294664; ENSG00000162643. [Q8IWG1-1]
ENST00000326813; ENSP00000317463; ENSG00000162643. [Q8IWG1-2]
ENST00000370596; ENSP00000359628; ENSG00000162643. [Q8IWG1-2]
GeneIDi126820.
KEGGihsa:126820.
UCSCiuc001dkt.5. human. [Q8IWG1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY049724 mRNA. Translation: AAL06239.1.
AK054629 mRNA. Translation: BAB70778.1.
AK292603 mRNA. Translation: BAF85292.1.
AL358789 Genomic DNA. Translation: CAI14916.1.
AL358789 Genomic DNA. Translation: CAI14917.1.
CH471097 Genomic DNA. Translation: EAW73212.1.
BC040265 mRNA. Translation: AAH40265.1.
CCDSiCCDS702.1. [Q8IWG1-1]
CCDS72818.1. [Q8IWG1-2]
RefSeqiNP_001275492.1. NM_001288563.1. [Q8IWG1-2]
NP_660155.2. NM_145172.4. [Q8IWG1-1]
UniGeneiHs.97933.

3D structure databases

ProteinModelPortaliQ8IWG1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126018. 1 interactor.
STRINGi9606.ENSP00000294664.

PTM databases

iPTMnetiQ8IWG1.
PhosphoSitePlusiQ8IWG1.

Polymorphism and mutation databases

BioMutaiWDR63.
DMDMi74759634.

Proteomic databases

MaxQBiQ8IWG1.
PaxDbiQ8IWG1.
PeptideAtlasiQ8IWG1.
PRIDEiQ8IWG1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000294664; ENSP00000294664; ENSG00000162643. [Q8IWG1-1]
ENST00000326813; ENSP00000317463; ENSG00000162643. [Q8IWG1-2]
ENST00000370596; ENSP00000359628; ENSG00000162643. [Q8IWG1-2]
GeneIDi126820.
KEGGihsa:126820.
UCSCiuc001dkt.5. human. [Q8IWG1-1]

Organism-specific databases

CTDi126820.
DisGeNETi126820.
GeneCardsiWDR63.
HGNCiHGNC:30711. WDR63.
HPAiHPA038066.
HPA038526.
neXtProtiNX_Q8IWG1.
OpenTargetsiENSG00000162643.
PharmGKBiPA142670596.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IU33. Eukaryota.
ENOG410XSJT. LUCA.
GeneTreeiENSGT00840000129862.
HOGENOMiHOG000013188.
HOVERGENiHBG069410.
InParanoidiQ8IWG1.
OMAiYGHVSRI.
OrthoDBiEOG091G01MQ.
PhylomeDBiQ8IWG1.
TreeFamiTF326991.

Enzyme and pathway databases

SignaLinkiQ8IWG1.

Miscellaneous databases

GenomeRNAii126820.
PROiQ8IWG1.

Gene expression databases

BgeeiENSG00000162643.
CleanExiHS_WDR63.
ExpressionAtlasiQ8IWG1. baseline and differential.
GenevisibleiQ8IWG1. HS.

Family and domain databases

Gene3Di2.130.10.10. 3 hits.
InterProiIPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
SMARTiSM00320. WD40. 3 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 2 hits.
PROSITEiPS00678. WD_REPEATS_1. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiWDR63_HUMAN
AccessioniPrimary (citable) accession number: Q8IWG1
Secondary accession number(s): A8K988, Q96L72, Q96NU4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: March 1, 2003
Last modified: November 2, 2016
This is version 128 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.