SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8IWG1

- WDR63_HUMAN

UniProt

Q8IWG1 - WDR63_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

WD repeat-containing protein 63

Gene
WDR63
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5 - Experimental evidence at transcript leveli

Functioni

Enzyme and pathway databases

SignaLinkiQ8IWG1.

Names & Taxonomyi

Protein namesi
Recommended name:
WD repeat-containing protein 63
Alternative name(s):
Testis development protein NYD-SP29
Gene namesi
Name:WDR63
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:30711. WDR63.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142670596.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 891891WD repeat-containing protein 63PRO_0000233162Add
BLAST

Proteomic databases

PaxDbiQ8IWG1.
PRIDEiQ8IWG1.

PTM databases

PhosphoSiteiQ8IWG1.

Expressioni

Gene expression databases

ArrayExpressiQ8IWG1.
BgeeiQ8IWG1.
CleanExiHS_WDR63.
GenevestigatoriQ8IWG1.

Organism-specific databases

HPAiHPA038066.
HPA038526.

Interactioni

Protein-protein interaction databases

BioGridi126018. 1 interaction.
STRINGi9606.ENSP00000294664.

Structurei

3D structure databases

ProteinModelPortaliQ8IWG1.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati395 – 43541WD 1Add
BLAST
Repeati477 – 53357WD 2Add
BLAST
Repeati670 – 70940WD 3Add
BLAST
Repeati713 – 75341WD 4Add
BLAST
Repeati761 – 80040WD 5Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili818 – 86144 Reviewed predictionAdd
BLAST

Sequence similaritiesi

Contains 5 WD repeats.

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

eggNOGiNOG261484.
HOGENOMiHOG000013188.
HOVERGENiHBG069410.
InParanoidiQ8IWG1.
OMAiVTCSADC.
OrthoDBiEOG7HMS0Z.
PhylomeDBiQ8IWG1.
TreeFamiTF326991.

Family and domain databases

Gene3Di2.130.10.10. 3 hits.
InterProiIPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF00400. WD40. 1 hit.
[Graphical view]
SMARTiSM00320. WD40. 3 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 2 hits.
PROSITEiPS00678. WD_REPEATS_1. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8IWG1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAPKQKKKTS RGKKRLKPVL AASEDMEPVN MESMGHPEIY PLVLTTKTQE    50
IFNCRIDEDV TDEQPYKLIN KEDIFEDLRN RAAVSDFHPV KKIVQEYPGN 100
ELLLVYDKDF KYGLNFYLIA TEEGKENYLN PPEVPEEQEE YKEHIPEDVY 150
IYKPPVSKPW VSLGSEKEIE EESVTESTKQ ITYMISRKRS EFGAPIKFSD 200
QNASSVKDAY IECTAYPDKN FTLKQLEKDV GMQVIPQIKD ISTQTKWTYP 250
KNATTQYYPR EFSEEEKETL KQSKPLVDFL NNASISVEIA LQQNEIMNTF 300
IDDWKYLAEE EGTFGDKTDT HLKEYQSFTD LHSPTEKMIT CVSWHPTIYG 350
LIAVSVAVRL SFEDRVHFSG KLLLQPSLIL FWSFSDPIHP QLMLESPDDI 400
FCFKFCPSDP NIIAGGCING QIVMWDITAH ADRIENIKAG GSRSKRATLK 450
PMFLLEPESN KEAMYIRHCA VSSIENGHKK VITDIHWLSD TFEINRMGSV 500
FENRSGICCQ LVTCSADCTI CFWDIRPQKP LTPQTTEKKK EESIEIPFDV 550
PSTFLHLDLS WKPLTKVRLS KGETSLDHCP TKISLNEDHL LCKTQDKMLA 600
QSKTEKAEEM NPYHNLESGM ANLLKPIDDF CTKFFVGTEE GEVIYTDWKM 650
EKDPETGRLM SKKPVSHHTI HDGTVHTIQR SPFYNDIILT VGGWNVAIWK 700
EGVMTGPLLQ SCCAPKRYTS GHWSLTRPGV FYIGREDGYI DIWDLLEKTH 750
EPAQSQNICI TMITYIKPWI FSSKQQFIAT ADYYGTLHIL EIPWTLSRPS 800
TNEMASVNHY FEREVKHLEY VEQRKKIREQ EKKEMELEMA KKKVKTYQKS 850
KEQMQAELKM DYESYLELEK TVLINLGLIK VTEKGSYMEV M 891
Length:891
Mass (Da):102,935
Last modified:March 1, 2003 - v1
Checksum:i982EA7B814BCC1F1
GO
Isoform 2 (identifier: Q8IWG1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     247-286: WTYPKNATTQYYPREFSEEEKETLKQSKPLVDFLNNASIS → C

Note: No experimental confirmation available.

Show »
Length:852
Mass (Da):98,301
Checksum:iAC62D7D6F05AE2E0
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti674 – 6741T → A.
Corresponds to variant rs17121745 [ dbSNP | Ensembl ].
VAR_057630
Natural varianti798 – 7981R → H.
Corresponds to variant rs709783 [ dbSNP | Ensembl ].
VAR_057631

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei247 – 28640WTYPK…NASIS → C in isoform 2. VSP_018080Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti108 – 1081K → E in AAL06239. 1 Publication
Sequence conflicti441 – 4411G → D in AAL06239. 1 Publication
Sequence conflicti496 – 4961R → G in AAL06239. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY049724 mRNA. Translation: AAL06239.1.
AK054629 mRNA. Translation: BAB70778.1.
AK292603 mRNA. Translation: BAF85292.1.
AL358789 Genomic DNA. Translation: CAI14916.1.
AL358789 Genomic DNA. Translation: CAI14917.1.
CH471097 Genomic DNA. Translation: EAW73212.1.
BC040265 mRNA. Translation: AAH40265.1.
CCDSiCCDS702.1. [Q8IWG1-1]
RefSeqiNP_001275492.1. NM_001288563.1. [Q8IWG1-2]
NP_660155.2. NM_145172.4. [Q8IWG1-1]
UniGeneiHs.97933.

Genome annotation databases

EnsembliENST00000294664; ENSP00000294664; ENSG00000162643. [Q8IWG1-1]
ENST00000326813; ENSP00000317463; ENSG00000162643. [Q8IWG1-2]
ENST00000370596; ENSP00000359628; ENSG00000162643. [Q8IWG1-2]
GeneIDi126820.
KEGGihsa:126820.
UCSCiuc001dkt.3. human. [Q8IWG1-1]
uc009wcl.3. human. [Q8IWG1-2]

Polymorphism databases

DMDMi74759634.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY049724 mRNA. Translation: AAL06239.1 .
AK054629 mRNA. Translation: BAB70778.1 .
AK292603 mRNA. Translation: BAF85292.1 .
AL358789 Genomic DNA. Translation: CAI14916.1 .
AL358789 Genomic DNA. Translation: CAI14917.1 .
CH471097 Genomic DNA. Translation: EAW73212.1 .
BC040265 mRNA. Translation: AAH40265.1 .
CCDSi CCDS702.1. [Q8IWG1-1 ]
RefSeqi NP_001275492.1. NM_001288563.1. [Q8IWG1-2 ]
NP_660155.2. NM_145172.4. [Q8IWG1-1 ]
UniGenei Hs.97933.

3D structure databases

ProteinModelPortali Q8IWG1.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 126018. 1 interaction.
STRINGi 9606.ENSP00000294664.

PTM databases

PhosphoSitei Q8IWG1.

Polymorphism databases

DMDMi 74759634.

Proteomic databases

PaxDbi Q8IWG1.
PRIDEi Q8IWG1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000294664 ; ENSP00000294664 ; ENSG00000162643 . [Q8IWG1-1 ]
ENST00000326813 ; ENSP00000317463 ; ENSG00000162643 . [Q8IWG1-2 ]
ENST00000370596 ; ENSP00000359628 ; ENSG00000162643 . [Q8IWG1-2 ]
GeneIDi 126820.
KEGGi hsa:126820.
UCSCi uc001dkt.3. human. [Q8IWG1-1 ]
uc009wcl.3. human. [Q8IWG1-2 ]

Organism-specific databases

CTDi 126820.
GeneCardsi GC01P085464.
HGNCi HGNC:30711. WDR63.
HPAi HPA038066.
HPA038526.
neXtProti NX_Q8IWG1.
PharmGKBi PA142670596.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG261484.
HOGENOMi HOG000013188.
HOVERGENi HBG069410.
InParanoidi Q8IWG1.
OMAi VTCSADC.
OrthoDBi EOG7HMS0Z.
PhylomeDBi Q8IWG1.
TreeFami TF326991.

Enzyme and pathway databases

SignaLinki Q8IWG1.

Miscellaneous databases

GenomeRNAii 126820.
NextBioi 81927.
PROi Q8IWG1.

Gene expression databases

ArrayExpressi Q8IWG1.
Bgeei Q8IWG1.
CleanExi HS_WDR63.
Genevestigatori Q8IWG1.

Family and domain databases

Gene3Di 2.130.10.10. 3 hits.
InterProi IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view ]
Pfami PF00400. WD40. 1 hit.
[Graphical view ]
SMARTi SM00320. WD40. 3 hits.
[Graphical view ]
SUPFAMi SSF50978. SSF50978. 2 hits.
PROSITEi PS00678. WD_REPEATS_1. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "NYD-SP29: a new gene related to testis development."
    Sha J.H.
    Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Testis.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Astrocyte and Testis.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.

Entry informationi

Entry nameiWDR63_HUMAN
AccessioniPrimary (citable) accession number: Q8IWG1
Secondary accession number(s): A8K988, Q96L72, Q96NU4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: March 1, 2003
Last modified: July 9, 2014
This is version 109 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi