Q8IWC1 (MA7D3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 72.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: MAP7 domain-containing protein 3 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 876 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subcellular location | Cytoplasm › cytoskeleton › spindle. Note: Localizes to the microtubules throughout mitosis. Ref.6 |
| Sequence similarities | Belongs to the MAP7 family. |
| Sequence caution | The sequence AAH64350.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence. The sequence CAM21578.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Cytoskeleton |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | centrosome Inferred from direct assay. Source: HPA cytoplasmInferred from direct assay. Source: HPA nucleusInferred from direct assay. Source: HPA spindleInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8IWC1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8IWC1-2) The sequence of this isoform differs from the canonical sequence as follows: 246-286: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q8IWC1-3) The sequence of this isoform differs from the canonical sequence as follows: 179-214: ANKRSASTEKLEQGTSALIRQMPLSSAGLQNSVAKR → G | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q8IWC1-4) The sequence of this isoform differs from the canonical sequence as follows: 1-23: MMADGAAAGAGGSPSLRELRARM → MTSPR | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 876 | 876 | MAP7 domain-containing protein 3 | PRO_0000306812 | |||||
Regions | |||||||||
| Coiled coil | 65 – 144 | 80 | Potential | ||||||
| Coiled coil | 558 – 640 | 83 | Potential | ||||||
| Coiled coil | 689 – 724 | 36 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 322 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 457 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 461 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 524 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 770 | 1 | Phosphoserine Ref.9 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 23 | 23 | MMADG…LRARM → MTSPR in isoform 4. | VSP_045008 | |||||
| Alternative sequence | 179 – 214 | 36 | ANKRS…SVAKR → G in isoform 3. | VSP_028498 | |||||
| Alternative sequence | 246 – 286 | 41 | Missing in isoform 2. | VSP_028499 | |||||
| Natural variant | 502 | 1 | E → A. Ref.5 Corresponds to variant rs1055497 [ dbSNP | Ensembl ]. | VAR_035314 | |||||
| Natural variant | 628 | 1 | Q → R. Ref.5 Corresponds to variant rs2273221 [ dbSNP | Ensembl ]. | VAR_035315 | |||||
Experimental info | |||||||||
| Sequence conflict | 71 | 1 | L → S in BAG62994. Ref.1 | ||||||
| Sequence conflict | 447 | 1 | K → R in BAG62994. Ref.1 | ||||||
| Sequence conflict | 448 | 1 | A → T in AAH40518. Ref.5 | ||||||
| Sequence conflict | 623 | 1 | R → Q in AL832120. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 701-876 (ISOFORMS 1/2/3). Tissue: Synovium and Teratocarcinoma. |
| [2] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Cervix. |
| [3] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS ALA-502 AND ARG-628. Tissue: Brain and Prostate. |
| [6] | "Proteome analysis of the human mitotic spindle." Sauer G., Koerner R., Hanisch A., Ries A., Nigg E.A., Sillje H.H.W. Mol. Cell. Proteomics 4:35-43(2005) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, MASS SPECTROMETRY. |
| [7] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-322; SER-457; SER-461 AND SER-524, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Leukemic T-cell. |
| [9] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-770, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [11] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK022711 mRNA. Translation: BAB14195.1. AK301478 mRNA. Translation: BAG62994.1. AL832120 mRNA. No translation available. AL078638 Genomic DNA. Translation: CAI41063.2. AL078638 Genomic DNA. Translation: CAI41064.2. AL078638 Genomic DNA. Translation: CAM21578.1. Sequence problems. CH471150 Genomic DNA. Translation: EAW88475.1. BC040518 mRNA. Translation: AAH40518.1. BC064350 mRNA. Translation: AAH64350.1. Sequence problems. |
| IPI | IPI00217264. IPI00386897. IPI00786887. IPI00847637. |
| RefSeq | NP_001166987.1. NM_001173516.1. NP_001166988.1. NM_001173517.1. NP_078873.2. NM_024597.3. |
| UniGene | Hs.446275. |
3D structure databases | |
| ProteinModelPortal | Q8IWC1. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8IWC1. 1 interaction. |
| STRING | 9606.ENSP00000318086. |
PTM databases | |
| PhosphoSite | Q8IWC1. |
Polymorphism databases | |
| DMDM | 158705880. |
Proteomic databases | |
| PaxDb | Q8IWC1. |
| PRIDE | Q8IWC1. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000316077; ENSP00000318086; ENSG00000129680. ENST00000370660; ENSP00000359694; ENSG00000129680. ENST00000370661; ENSP00000359695; ENSG00000129680. ENST00000370663; ENSP00000359697; ENSG00000129680. |
| GeneID | 79649. |
| KEGG | hsa:79649. |
| UCSC | uc004ezs.3. human. uc004ezt.3. human. uc010nsa.2. human. |
Organism-specific databases | |
| CTD | 79649. |
| GeneCards | GC0XM135295. |
| H-InvDB | HIX0017079. |
| HGNC | HGNC:25742. MAP7D3. |
| HPA | HPA035598. |
| neXtProt | NX_Q8IWC1. |
| PharmGKB | PA162394972. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG113680. |
| HOVERGEN | HBG103577. |
| InParanoid | Q8IWC1. |
| KO | K16807. |
| OMA | SMEASPK. |
Gene expression databases | |
| ArrayExpress | Q8IWC1. |
| Bgee | Q8IWC1. |
| CleanEx | HS_MAP7D3. |
| Genevestigator | Q8IWC1. |
Family and domain databases | |
| InterPro | IPR008604. E-MAP-115. [Graphical view] |
| PANTHER | PTHR15073. PTHR15073. 1 hit. |
| Pfam | PF05672. MAP7. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 79649. |
| NextBio | 68800. |
Entry information
| Entry name | MA7D3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8IWC1 Secondary accession number(s): A2A2J0 Q9H9M8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
