Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8IWC1

- MA7D3_HUMAN

UniProt

Q8IWC1 - MA7D3_HUMAN

Protein

MAP7 domain-containing protein 3

Gene

MAP7D3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 86 (01 Oct 2014)
      Sequence version 2 (02 Oct 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Biological processi

    1. microtubule cytoskeleton organization Source: InterPro

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    MAP7 domain-containing protein 3
    Gene namesi
    Name:MAP7D3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome X

    Organism-specific databases

    HGNCiHGNC:25742. MAP7D3.

    Subcellular locationi

    Cytoplasmcytoskeletonspindle 1 Publication
    Note: Localizes to the microtubules throughout mitosis.

    GO - Cellular componenti

    1. centrosome Source: HPA
    2. cytoplasm Source: HPA
    3. membrane Source: UniProtKB
    4. microtubule Source: InterPro
    5. nucleus Source: HPA
    6. spindle Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Cytoskeleton

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162394972.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 876876MAP7 domain-containing protein 3PRO_0000306812Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionine1 Publication
    Modified residuei322 – 3221Phosphoserine1 Publication
    Modified residuei457 – 4571Phosphoserine1 Publication
    Modified residuei461 – 4611Phosphoserine1 Publication
    Modified residuei524 – 5241Phosphoserine1 Publication
    Modified residuei770 – 7701Phosphoserine1 Publication

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ8IWC1.
    PaxDbiQ8IWC1.
    PRIDEiQ8IWC1.

    PTM databases

    PhosphoSiteiQ8IWC1.

    Expressioni

    Gene expression databases

    BgeeiQ8IWC1.
    CleanExiHS_MAP7D3.
    GenevestigatoriQ8IWC1.

    Organism-specific databases

    HPAiHPA035598.

    Interactioni

    Protein-protein interaction databases

    BioGridi122777. 4 interactions.
    IntActiQ8IWC1. 1 interaction.
    MINTiMINT-4990235.
    STRINGi9606.ENSP00000318086.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8IWC1.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili65 – 14480Sequence AnalysisAdd
    BLAST
    Coiled coili558 – 64083Sequence AnalysisAdd
    BLAST
    Coiled coili689 – 72436Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Belongs to the MAP7 family.Curated

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG113680.
    HOVERGENiHBG103577.
    InParanoidiQ8IWC1.
    KOiK16807.
    OMAiQQDANKE.
    OrthoDBiEOG761BTS.
    PhylomeDBiQ8IWC1.
    TreeFamiTF332273.

    Family and domain databases

    InterProiIPR008604. MAP7.
    [Graphical view]
    PANTHERiPTHR15073. PTHR15073. 1 hit.
    PfamiPF05672. MAP7. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8IWC1-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MMADGAAAGA GGSPSLRELR ARMVAAANEI AKERRKQDVV NRVATHSSNI    50
    RSTFKPVIDG SMLKNDIKQR LARERREEKR RQQDANKETQ LLEKERKTKL 100
    QYEKQMEERQ RKLKERKEKE EQRRIAAEEK RHQKDEAQKE KFTAILYRTL 150
    ERRRLADDYQ QKRWSWGGSA MANSESKTAN KRSASTEKLE QGTSALIRQM 200
    PLSSAGLQNS VAKRKTDKER SSSLNRRDSN LHSSTDKEQA ERKPRVTGVT 250
    NYVMQYVTVP LRKCTSDELR AVMFPMSTMK IPPQTKVEES PLEKVETPPK 300
    ASVDAPPQVN VEVFCNTSME ASPKAGVGMA PEVSTDSFPV VSVDVSPVVS 350
    TYDSEMSMDA SPELSIEALP KVDLETVPKV SIVASPEASL EAPPEVSLEA 400
    LPEVSVEAAP EGSLEAPPKG SAEVAPKESV KGSPKESMEA SPEAMVKASP 450
    KTSLEASMEA SPKAKARDAP KKSEMDKQAL IPIAKKRLSS YTECYKWSSS 500
    PENACGLPSP ISTNRQIQKN CPPSPLPLIS KQSPQTSFPY KIMPIQHTLS 550
    VQSASSTVKK KKETVSKTTN RCEALSQRHM IYEESGNKST AGIMNAEAAT 600
    KILTELRRLA REQREKEEEE RQREEMQQRV IKKSKDMAKE AVGGQAEDHL 650
    KLKDGQQQNE TKKKKGWLDQ EDQEAPLQKG DAKIKAQEEA DKRKKEHERI 700
    MLQNLQERLE RKKRIEEIMK RTRKTDVNAS KVTETSSHDI YEEAEADNEE 750
    SDKDSLNEMF PSAILNGTGS PTKFKMPFNN AKKMTHKLVF LEDGTSQVRK 800
    EPKTYFNGDL KNFRQKSMKD TSIQEVVSRP SSKRMTSHTT KTRKADETNT 850
    TSRSSAQTKS EGFHDILPKS SDTFRQ 876
    Length:876
    Mass (Da):98,429
    Last modified:October 2, 2007 - v2
    Checksum:iC149899FB0002B39
    GO
    Isoform 2 (identifier: Q8IWC1-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         246-286: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:835
    Mass (Da):93,785
    Checksum:i636105ADE4362780
    GO
    Isoform 3 (identifier: Q8IWC1-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         179-214: ANKRSASTEKLEQGTSALIRQMPLSSAGLQNSVAKR → G

    Note: No experimental confirmation available.

    Show »
    Length:841
    Mass (Da):94,675
    Checksum:i991CB99A9EA667C2
    GO
    Isoform 4 (identifier: Q8IWC1-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-23: MMADGAAAGAGGSPSLRELRARM → MTSPR

    Note: No experimental confirmation available.

    Show »
    Length:858
    Mass (Da):96,743
    Checksum:i46B3C99CFE457147
    GO

    Sequence cautioni

    The sequence AAH64350.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.
    The sequence CAM21578.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti71 – 711L → S in BAG62994. (PubMed:14702039)Curated
    Sequence conflicti447 – 4471K → R in BAG62994. (PubMed:14702039)Curated
    Sequence conflicti448 – 4481A → T in AAH40518. (PubMed:15489334)Curated
    Sequence conflicti623 – 6231R → Q in AL832120. (PubMed:17974005)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti502 – 5021E → A.1 Publication
    Corresponds to variant rs1055497 [ dbSNP | Ensembl ].
    VAR_035314
    Natural varianti628 – 6281Q → R.1 Publication
    Corresponds to variant rs2273221 [ dbSNP | Ensembl ].
    VAR_035315

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 2323MMADG…LRARM → MTSPR in isoform 4. 1 PublicationVSP_045008Add
    BLAST
    Alternative sequencei179 – 21436ANKRS…SVAKR → G in isoform 3. 1 PublicationVSP_028498Add
    BLAST
    Alternative sequencei246 – 28641Missing in isoform 2. 1 PublicationVSP_028499Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK022711 mRNA. Translation: BAB14195.1.
    AK301478 mRNA. Translation: BAG62994.1.
    AL832120 mRNA. No translation available.
    AL078638 Genomic DNA. Translation: CAI41063.2.
    AL078638 Genomic DNA. Translation: CAI41064.2.
    AL078638 Genomic DNA. Translation: CAM21578.1. Sequence problems.
    CH471150 Genomic DNA. Translation: EAW88475.1.
    BC040518 mRNA. Translation: AAH40518.1.
    BC064350 mRNA. Translation: AAH64350.1. Sequence problems.
    CCDSiCCDS44004.1. [Q8IWC1-1]
    CCDS55508.1. [Q8IWC1-3]
    CCDS55509.1. [Q8IWC1-4]
    RefSeqiNP_001166987.1. NM_001173516.1. [Q8IWC1-4]
    NP_001166988.1. NM_001173517.1. [Q8IWC1-3]
    NP_078873.2. NM_024597.3. [Q8IWC1-1]
    UniGeneiHs.446275.

    Genome annotation databases

    EnsembliENST00000316077; ENSP00000318086; ENSG00000129680. [Q8IWC1-1]
    ENST00000370661; ENSP00000359695; ENSG00000129680. [Q8IWC1-3]
    ENST00000370663; ENSP00000359697; ENSG00000129680. [Q8IWC1-4]
    GeneIDi79649.
    KEGGihsa:79649.
    UCSCiuc004ezs.3. human. [Q8IWC1-3]
    uc004ezt.3. human. [Q8IWC1-1]
    uc010nsa.2. human. [Q8IWC1-2]

    Polymorphism databases

    DMDMi158705880.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK022711 mRNA. Translation: BAB14195.1 .
    AK301478 mRNA. Translation: BAG62994.1 .
    AL832120 mRNA. No translation available.
    AL078638 Genomic DNA. Translation: CAI41063.2 .
    AL078638 Genomic DNA. Translation: CAI41064.2 .
    AL078638 Genomic DNA. Translation: CAM21578.1 . Sequence problems.
    CH471150 Genomic DNA. Translation: EAW88475.1 .
    BC040518 mRNA. Translation: AAH40518.1 .
    BC064350 mRNA. Translation: AAH64350.1 . Sequence problems.
    CCDSi CCDS44004.1. [Q8IWC1-1 ]
    CCDS55508.1. [Q8IWC1-3 ]
    CCDS55509.1. [Q8IWC1-4 ]
    RefSeqi NP_001166987.1. NM_001173516.1. [Q8IWC1-4 ]
    NP_001166988.1. NM_001173517.1. [Q8IWC1-3 ]
    NP_078873.2. NM_024597.3. [Q8IWC1-1 ]
    UniGenei Hs.446275.

    3D structure databases

    ProteinModelPortali Q8IWC1.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122777. 4 interactions.
    IntActi Q8IWC1. 1 interaction.
    MINTi MINT-4990235.
    STRINGi 9606.ENSP00000318086.

    PTM databases

    PhosphoSitei Q8IWC1.

    Polymorphism databases

    DMDMi 158705880.

    Proteomic databases

    MaxQBi Q8IWC1.
    PaxDbi Q8IWC1.
    PRIDEi Q8IWC1.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000316077 ; ENSP00000318086 ; ENSG00000129680 . [Q8IWC1-1 ]
    ENST00000370661 ; ENSP00000359695 ; ENSG00000129680 . [Q8IWC1-3 ]
    ENST00000370663 ; ENSP00000359697 ; ENSG00000129680 . [Q8IWC1-4 ]
    GeneIDi 79649.
    KEGGi hsa:79649.
    UCSCi uc004ezs.3. human. [Q8IWC1-3 ]
    uc004ezt.3. human. [Q8IWC1-1 ]
    uc010nsa.2. human. [Q8IWC1-2 ]

    Organism-specific databases

    CTDi 79649.
    GeneCardsi GC0XM135295.
    H-InvDB HIX0017079.
    HGNCi HGNC:25742. MAP7D3.
    HPAi HPA035598.
    neXtProti NX_Q8IWC1.
    PharmGKBi PA162394972.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG113680.
    HOVERGENi HBG103577.
    InParanoidi Q8IWC1.
    KOi K16807.
    OMAi QQDANKE.
    OrthoDBi EOG761BTS.
    PhylomeDBi Q8IWC1.
    TreeFami TF332273.

    Miscellaneous databases

    GenomeRNAii 79649.
    NextBioi 68800.
    PROi Q8IWC1.

    Gene expression databases

    Bgeei Q8IWC1.
    CleanExi HS_MAP7D3.
    Genevestigatori Q8IWC1.

    Family and domain databases

    InterProi IPR008604. MAP7.
    [Graphical view ]
    PANTHERi PTHR15073. PTHR15073. 1 hit.
    Pfami PF05672. MAP7. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 701-876 (ISOFORMS 1/2/3).
      Tissue: Synovium and Teratocarcinoma.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Cervix.
    3. "The DNA sequence of the human X chromosome."
      Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
      , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
      Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS ALA-502 AND ARG-628.
      Tissue: Brain and Prostate.
    6. Cited for: SUBCELLULAR LOCATION, IDENTIFICATION BY MASS SPECTROMETRY.
    7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-322; SER-457; SER-461 AND SER-524, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    9. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    10. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-770, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    12. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    13. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiMA7D3_HUMAN
    AccessioniPrimary (citable) accession number: Q8IWC1
    Secondary accession number(s): A2A2J0
    , A6NCZ7, A6NHR4, B4DWD2, H7BY77, Q5JXI5, Q5JXI6, Q6P2S1, Q9H9M8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 2, 2007
    Last sequence update: October 2, 2007
    Last modified: October 1, 2014
    This is version 86 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3