Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8IWA5

- CTL2_HUMAN

UniProt

Q8IWA5 - CTL2_HUMAN

Protein

Choline transporter-like protein 2

Gene

SLC44A2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 107 (01 Oct 2014)
      Sequence version 3 (02 Nov 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Isoform 1, but not isoform 3, exhibits some choline transporter activity.2 Publications

    GO - Molecular functioni

    1. choline transmembrane transporter activity Source: UniProtKB
    2. signal transducer activity Source: UniProtKB

    GO - Biological processi

    1. choline transport Source: UniProtKB
    2. glycerophospholipid biosynthetic process Source: Reactome
    3. phosphatidylcholine biosynthetic process Source: Reactome
    4. phospholipid metabolic process Source: Reactome
    5. positive regulation of I-kappaB kinase/NF-kappaB signaling Source: UniProtKB
    6. signal transduction Source: GOC
    7. small molecule metabolic process Source: Reactome
    8. transmembrane transport Source: Reactome

    Keywords - Biological processi

    Transport

    Enzyme and pathway databases

    ReactomeiREACT_121238. Synthesis of PC.
    REACT_19305. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.

    Protein family/group databases

    TCDBi2.A.92.1.4. the choline transporter-like (ctl) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Choline transporter-like protein 2
    Alternative name(s):
    Solute carrier family 44 member 2
    Gene namesi
    Name:SLC44A2
    Synonyms:CTL2
    ORF Names:PSEC0210
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:17292. SLC44A2.

    Subcellular locationi

    Membrane By similarity; Multi-pass membrane protein By similarity

    GO - Cellular componenti

    1. extracellular vesicular exosome Source: UniProt
    2. integral component of membrane Source: UniProtKB
    3. lysosomal membrane Source: UniProtKB
    4. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142670899.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 706706Choline transporter-like protein 2PRO_0000191717Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi187 – 1871N-linked (GlcNAc...)2 Publications
    Glycosylationi200 – 2001N-linked (GlcNAc...)2 Publications
    Glycosylationi417 – 4171N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    MaxQBiQ8IWA5.
    PaxDbiQ8IWA5.
    PeptideAtlasiQ8IWA5.
    PRIDEiQ8IWA5.

    PTM databases

    PhosphoSiteiQ8IWA5.

    Expressioni

    Tissue specificityi

    Present in supporting cells of the inner ear (at protein level). Only isoform 3 is expressed in inner ear vestibular tissue.2 Publications

    Gene expression databases

    ArrayExpressiQ8IWA5.
    BgeeiQ8IWA5.
    CleanExiHS_SLC44A2.
    GenevestigatoriQ8IWA5.

    Organism-specific databases

    HPAiHPA003228.

    Interactioni

    Subunit structurei

    Interacts with COCH.1 Publication

    Protein-protein interaction databases

    BioGridi121410. 2 interactions.
    MINTiMINT-5006445.
    STRINGi9606.ENSP00000336888.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8IWA5.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 3333CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini55 – 232178ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini254 – 2563CytoplasmicSequence Analysis
    Topological domaini278 – 31538ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini337 – 36428CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini386 – 45772ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini481 – 50424CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini526 – 56338ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini585 – 59915CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini621 – 63818ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini660 – 70647CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei34 – 5421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei233 – 25321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei257 – 27721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei316 – 33621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei365 – 38521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei458 – 48023HelicalSequence AnalysisAdd
    BLAST
    Transmembranei505 – 52521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei564 – 58421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei600 – 62021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei639 – 65921HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG310633.
    HOVERGENiHBG062155.
    InParanoidiQ8IWA5.
    KOiK15377.
    OMAiQTWMAFM.
    OrthoDBiEOG7FR7G4.
    PhylomeDBiQ8IWA5.
    TreeFamiTF313325.

    Family and domain databases

    InterProiIPR007603. Choline_transptr-like.
    [Graphical view]
    PANTHERiPTHR12385. PTHR12385. 1 hit.
    PfamiPF04515. Choline_transpo. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative promoter usage and alternative splicing. Align

    Isoform 1 (identifier: Q8IWA5-1) [UniParc]FASTAAdd to Basket

    Also known as: CTL2a, CTL2P2A

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGDERPHYYG KHGTPQKYDP TFKGPIYNRG CTDIICCVFL LLAIVGYVAV    50
    GIIAWTHGDP RKVIYPTDSR GEFCGQKGTK NENKPYLFYF NIVKCASPLV 100
    LLEFQCPTPQ ICVEKCPDRY LTYLNARSSR DFEYYKQFCV PGFKNNKGVA 150
    EVLQDGDCPA VLIPSKPLAR RCFPAIHAYK GVLMVGNETT YEDGHGSRKN 200
    ITDLVEGAKK ANGVLEARQL AMRIFEDYTV SWYWIIIGLV IAMAMSLLFI 250
    ILLRFLAGIM VWVMIIMVIL VLGYGIFHCY MEYSRLRGEA GSDVSLVDLG 300
    FQTDFRVYLH LRQTWLAFMI ILSILEVIII LLLIFLRKRI LIAIALIKEA 350
    SRAVGYVMCS LLYPLVTFFL LCLCIAYWAS TAVFLSTSNE AVYKIFDDSP 400
    CPFTAKTCNP ETFPSSNESR QCPNARCQFA FYGGESGYHR ALLGLQIFNA 450
    FMFFWLANFV LALGQVTLAG AFASYYWALR KPDDLPAFPL FSAFGRALRY 500
    HTGSLAFGAL ILAIVQIIRV ILEYLDQRLK AAENKFAKCL MTCLKCCFWC 550
    LEKFIKFLNR NAYIMIAIYG TNFCTSARNA FFLLMRNIIR VAVLDKVTDF 600
    LFLLGKLLIV GSVGILAFFF FTHRIRIVQD TAPPLNYYWV PILTVIVGSY 650
    LIAHGFFSVY GMCVDTLFLC FLEDLERNDG SAERPYFMSS TLKKLLNKTN 700
    KKAAES 706
    Length:706
    Mass (Da):80,124
    Last modified:November 2, 2010 - v3
    Checksum:i9A044A531930326E
    GO
    Isoform 2 (identifier: Q8IWA5-2) [UniParc]FASTAAdd to Basket

    Also known as: CTL2b, CTL2P2B

    The sequence of this isoform differs from the canonical sequence as follows:
         672-706: LEDLERNDGSAERPYFMSSTLKKLLNKTNKKAAES → CEDLERNDGSQERPYFMSPELRDILLKGSAEEGKRAEAEE

    Show »
    Length:711
    Mass (Da):80,737
    Checksum:iFF8B042AFDEBA26C
    GO
    Isoform 3 (identifier: Q8IWA5-3) [UniParc]FASTAAdd to Basket

    Also known as: CTL2P1

    The sequence of this isoform differs from the canonical sequence as follows:
         1-12: MGDERPHYYGKH → MEDERKNGAY

    Note: Produced by alternative promoter usage.

    Show »
    Length:704
    Mass (Da):79,846
    Checksum:i9B2CB6047E5FCDD6
    GO

    Sequence cautioni

    The sequence BAC11662.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti92 – 921I → T in BAG51335. (PubMed:14702039)Curated
    Sequence conflicti153 – 1531L → F in CBJ93592. 1 PublicationCurated
    Sequence conflicti531 – 5311A → G in CAB75542. (PubMed:10677542)Curated
    Sequence conflicti695 – 6951L → P in AAH40556. (PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti154 – 1541Q → R.6 Publications
    Corresponds to variant rs2288904 [ dbSNP | Ensembl ].
    VAR_023404

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1212MGDER…YYGKH → MEDERKNGAY in isoform 3. 2 PublicationsVSP_041792Add
    BLAST
    Alternative sequencei672 – 70635LEDLE…KAAES → CEDLERNDGSQERPYFMSPE LRDILLKGSAEEGKRAEAEE in isoform 2. 2 PublicationsVSP_015431Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ245621 Genomic DNA. Translation: CAB75542.1.
    FN668568 mRNA. Translation: CBJ93592.1.
    AK027519 mRNA. Translation: BAG51335.1.
    AK294118 mRNA. Translation: BAG57451.1.
    AK314582 mRNA. Translation: BAG37158.1.
    AC011475 Genomic DNA. No translation available.
    CH471106 Genomic DNA. Translation: EAW84126.1.
    BC010617 mRNA. Translation: AAH10617.1.
    BC040556 mRNA. Translation: AAH40556.1.
    AL832517 mRNA. Translation: CAH56352.1.
    AL832978 mRNA. Translation: CAH56342.1.
    AK075512 mRNA. Translation: BAC11662.1. Different initiation.
    AF070636 mRNA. No translation available.
    CCDSiCCDS12245.1. [Q8IWA5-1]
    CCDS54216.1. [Q8IWA5-3]
    RefSeqiNP_001138528.1. NM_001145056.1. [Q8IWA5-3]
    NP_065161.3. NM_020428.3. [Q8IWA5-1]
    XP_005260054.1. XM_005259997.1. [Q8IWA5-2]
    XP_005260055.1. XM_005259998.1. [Q8IWA5-2]
    UniGeneiHs.534560.

    Genome annotation databases

    EnsembliENST00000335757; ENSP00000336888; ENSG00000129353. [Q8IWA5-1]
    ENST00000407327; ENSP00000385135; ENSG00000129353. [Q8IWA5-3]
    ENST00000586078; ENSP00000466664; ENSG00000129353. [Q8IWA5-2]
    GeneIDi57153.
    KEGGihsa:57153.
    UCSCiuc002mpe.4. human. [Q8IWA5-3]
    uc002mpf.3. human. [Q8IWA5-1]
    uc002mpg.1. human. [Q8IWA5-2]

    Polymorphism databases

    DMDMi311033462.

    Keywords - Coding sequence diversityi

    Alternative promoter usage, Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ245621 Genomic DNA. Translation: CAB75542.1 .
    FN668568 mRNA. Translation: CBJ93592.1 .
    AK027519 mRNA. Translation: BAG51335.1 .
    AK294118 mRNA. Translation: BAG57451.1 .
    AK314582 mRNA. Translation: BAG37158.1 .
    AC011475 Genomic DNA. No translation available.
    CH471106 Genomic DNA. Translation: EAW84126.1 .
    BC010617 mRNA. Translation: AAH10617.1 .
    BC040556 mRNA. Translation: AAH40556.1 .
    AL832517 mRNA. Translation: CAH56352.1 .
    AL832978 mRNA. Translation: CAH56342.1 .
    AK075512 mRNA. Translation: BAC11662.1 . Different initiation.
    AF070636 mRNA. No translation available.
    CCDSi CCDS12245.1. [Q8IWA5-1 ]
    CCDS54216.1. [Q8IWA5-3 ]
    RefSeqi NP_001138528.1. NM_001145056.1. [Q8IWA5-3 ]
    NP_065161.3. NM_020428.3. [Q8IWA5-1 ]
    XP_005260054.1. XM_005259997.1. [Q8IWA5-2 ]
    XP_005260055.1. XM_005259998.1. [Q8IWA5-2 ]
    UniGenei Hs.534560.

    3D structure databases

    ProteinModelPortali Q8IWA5.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 121410. 2 interactions.
    MINTi MINT-5006445.
    STRINGi 9606.ENSP00000336888.

    Chemistry

    DrugBanki DB00122. Choline.

    Protein family/group databases

    TCDBi 2.A.92.1.4. the choline transporter-like (ctl) family.

    PTM databases

    PhosphoSitei Q8IWA5.

    Polymorphism databases

    DMDMi 311033462.

    Proteomic databases

    MaxQBi Q8IWA5.
    PaxDbi Q8IWA5.
    PeptideAtlasi Q8IWA5.
    PRIDEi Q8IWA5.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000335757 ; ENSP00000336888 ; ENSG00000129353 . [Q8IWA5-1 ]
    ENST00000407327 ; ENSP00000385135 ; ENSG00000129353 . [Q8IWA5-3 ]
    ENST00000586078 ; ENSP00000466664 ; ENSG00000129353 . [Q8IWA5-2 ]
    GeneIDi 57153.
    KEGGi hsa:57153.
    UCSCi uc002mpe.4. human. [Q8IWA5-3 ]
    uc002mpf.3. human. [Q8IWA5-1 ]
    uc002mpg.1. human. [Q8IWA5-2 ]

    Organism-specific databases

    CTDi 57153.
    GeneCardsi GC19P010713.
    H-InvDB HIX0202740.
    HGNCi HGNC:17292. SLC44A2.
    HPAi HPA003228.
    MIMi 606106. gene.
    neXtProti NX_Q8IWA5.
    PharmGKBi PA142670899.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG310633.
    HOVERGENi HBG062155.
    InParanoidi Q8IWA5.
    KOi K15377.
    OMAi QTWMAFM.
    OrthoDBi EOG7FR7G4.
    PhylomeDBi Q8IWA5.
    TreeFami TF313325.

    Enzyme and pathway databases

    Reactomei REACT_121238. Synthesis of PC.
    REACT_19305. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.

    Miscellaneous databases

    ChiTaRSi SLC44A2. human.
    GeneWikii SLC44A2.
    GenomeRNAii 57153.
    NextBioi 63129.
    PROi Q8IWA5.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8IWA5.
    Bgeei Q8IWA5.
    CleanExi HS_SLC44A2.
    Genevestigatori Q8IWA5.

    Family and domain databases

    InterProi IPR007603. Choline_transptr-like.
    [Graphical view ]
    PANTHERi PTHR12385. PTHR12385. 1 hit.
    Pfami PF04515. Choline_transpo. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "An electric lobe suppressor for a yeast choline transport mutation belongs to a new family of transporter-like proteins."
      O'Regan S., Traiffort E., Ruat M., Cha N., Compaore D., Meunier F.-M.
      Proc. Natl. Acad. Sci. U.S.A. 97:1835-1840(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 1), FUNCTION, VARIANT ARG-154.
    2. "Identification and characterization of choline transporter-like protein 2, an inner ear glycoprotein of 68 and 72 kDa that is the target of antibody-induced hearing loss."
      Nair T.S., Kozma K.E., Hoefling N.L., Kommareddi P.K., Ueda Y., Gong T.-W., Lomax M.I., Lansford C.D., Telian S.A., Satar B., Arts H.A., El-Kashlan H.K., Berryhill W.E., Raphael Y., Carey T.E.
      J. Neurosci. 24:1772-1779(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), DISEASE, TISSUE SPECIFICITY, VARIANT ARG-154.
      Tissue: Epithelium and Inner ear.
    3. "Detection of HNA-3b antibodies in patient sera."
      Santoso S.S., Bayat B.B., Sachs U.
      Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 565-706 (ISOFORM 2), VARIANT ARG-154.
      Tissue: Brain cortex, Placenta and Teratocarcinoma.
    5. "The DNA sequence and biology of human chromosome 19."
      Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
      , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
      Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ARG-154.
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ARG-154.
      Tissue: Eye and Testis.
    8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 60-706 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 273-706 (ISOFORM 2), VARIANT ARG-154.
      Tissue: Stomach.
    9. "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries."
      Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y.
      , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.
      DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 321-706 (ISOFORM 1).
      Tissue: Embryo.
    10. Yu W., Gibbs R.A.
      Submitted (JUN-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 663-706 (ISOFORM 3).
    11. Cited for: INTERACTION WITH COCH.
    12. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
      Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
      J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-187 AND ASN-200.
      Tissue: Liver.
    13. "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
      Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
      Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-187 AND ASN-200.
      Tissue: Leukemic T-cell.
    14. "Isoforms, expression, glycosylation, and tissue distribution of CTL2/SLC44A2."
      Kommareddi P.K., Nair T.S., Thang L.V., Galano M.M., Babu E., Ganapathy V., Kanazawa T., McHugh J.B., Carey T.E.
      Protein J. 29:417-426(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, ALTERNATIVE PROMOTER USAGE, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiCTL2_HUMAN
    AccessioniPrimary (citable) accession number: Q8IWA5
    Secondary accession number(s): B2RBB1
    , B3KNH3, B4DFJ0, F2Q9D7, Q658V1, Q658Z2, Q6PJV7, Q8N2F0, Q9NY68
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 30, 2005
    Last sequence update: November 2, 2010
    Last modified: October 1, 2014
    This is version 107 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3