Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8IWA5

- CTL2_HUMAN

UniProt

Q8IWA5 - CTL2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Choline transporter-like protein 2

Gene

SLC44A2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Isoform 1, but not isoform 3, exhibits some choline transporter activity.2 Publications

GO - Molecular functioni

  1. choline transmembrane transporter activity Source: UniProtKB
  2. signal transducer activity Source: UniProtKB

GO - Biological processi

  1. choline transport Source: UniProtKB
  2. glycerophospholipid biosynthetic process Source: Reactome
  3. phosphatidylcholine biosynthetic process Source: Reactome
  4. phospholipid metabolic process Source: Reactome
  5. positive regulation of I-kappaB kinase/NF-kappaB signaling Source: UniProtKB
  6. signal transduction Source: GOC
  7. small molecule metabolic process Source: Reactome
  8. transmembrane transport Source: Reactome
Complete GO annotation...

Keywords - Biological processi

Transport

Enzyme and pathway databases

ReactomeiREACT_121238. Synthesis of PC.
REACT_19305. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.

Protein family/group databases

TCDBi2.A.92.1.4. the choline transporter-like (ctl) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Choline transporter-like protein 2
Alternative name(s):
Solute carrier family 44 member 2
Gene namesi
Name:SLC44A2
Synonyms:CTL2
ORF Names:PSEC0210
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:17292. SLC44A2.

Subcellular locationi

Membrane By similarity; Multi-pass membrane protein By similarity

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 3333CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei34 – 5421HelicalSequence AnalysisAdd
BLAST
Topological domaini55 – 232178ExtracellularSequence AnalysisAdd
BLAST
Transmembranei233 – 25321HelicalSequence AnalysisAdd
BLAST
Topological domaini254 – 2563CytoplasmicSequence Analysis
Transmembranei257 – 27721HelicalSequence AnalysisAdd
BLAST
Topological domaini278 – 31538ExtracellularSequence AnalysisAdd
BLAST
Transmembranei316 – 33621HelicalSequence AnalysisAdd
BLAST
Topological domaini337 – 36428CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei365 – 38521HelicalSequence AnalysisAdd
BLAST
Topological domaini386 – 45772ExtracellularSequence AnalysisAdd
BLAST
Transmembranei458 – 48023HelicalSequence AnalysisAdd
BLAST
Topological domaini481 – 50424CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei505 – 52521HelicalSequence AnalysisAdd
BLAST
Topological domaini526 – 56338ExtracellularSequence AnalysisAdd
BLAST
Transmembranei564 – 58421HelicalSequence AnalysisAdd
BLAST
Topological domaini585 – 59915CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei600 – 62021HelicalSequence AnalysisAdd
BLAST
Topological domaini621 – 63818ExtracellularSequence AnalysisAdd
BLAST
Transmembranei639 – 65921HelicalSequence AnalysisAdd
BLAST
Topological domaini660 – 70647CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. extracellular vesicular exosome Source: UniProtKB
  2. integral component of membrane Source: UniProtKB
  3. lysosomal membrane Source: UniProtKB
  4. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142670899.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 706706Choline transporter-like protein 2PRO_0000191717Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi187 – 1871N-linked (GlcNAc...)2 Publications
Glycosylationi200 – 2001N-linked (GlcNAc...)2 Publications
Glycosylationi417 – 4171N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ8IWA5.
PaxDbiQ8IWA5.
PeptideAtlasiQ8IWA5.
PRIDEiQ8IWA5.

PTM databases

PhosphoSiteiQ8IWA5.

Expressioni

Tissue specificityi

Present in supporting cells of the inner ear (at protein level). Only isoform 3 is expressed in inner ear vestibular tissue.2 Publications

Gene expression databases

BgeeiQ8IWA5.
CleanExiHS_SLC44A2.
ExpressionAtlasiQ8IWA5. baseline and differential.
GenevestigatoriQ8IWA5.

Organism-specific databases

HPAiHPA003228.

Interactioni

Subunit structurei

Interacts with COCH.1 Publication

Protein-protein interaction databases

BioGridi121410. 3 interactions.
MINTiMINT-5006445.
STRINGi9606.ENSP00000336888.

Structurei

3D structure databases

ProteinModelPortaliQ8IWA5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG310633.
GeneTreeiENSGT00550000074521.
HOVERGENiHBG062155.
InParanoidiQ8IWA5.
KOiK15377.
OMAiQTWMAFM.
OrthoDBiEOG7FR7G4.
PhylomeDBiQ8IWA5.
TreeFamiTF313325.

Family and domain databases

InterProiIPR007603. Choline_transptr-like.
[Graphical view]
PANTHERiPTHR12385. PTHR12385. 1 hit.
PfamiPF04515. Choline_transpo. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative promoter usage and alternative splicing. Align

Isoform 1 (identifier: Q8IWA5-1) [UniParc]FASTAAdd to Basket

Also known as: CTL2a, CTL2P2A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGDERPHYYG KHGTPQKYDP TFKGPIYNRG CTDIICCVFL LLAIVGYVAV
60 70 80 90 100
GIIAWTHGDP RKVIYPTDSR GEFCGQKGTK NENKPYLFYF NIVKCASPLV
110 120 130 140 150
LLEFQCPTPQ ICVEKCPDRY LTYLNARSSR DFEYYKQFCV PGFKNNKGVA
160 170 180 190 200
EVLQDGDCPA VLIPSKPLAR RCFPAIHAYK GVLMVGNETT YEDGHGSRKN
210 220 230 240 250
ITDLVEGAKK ANGVLEARQL AMRIFEDYTV SWYWIIIGLV IAMAMSLLFI
260 270 280 290 300
ILLRFLAGIM VWVMIIMVIL VLGYGIFHCY MEYSRLRGEA GSDVSLVDLG
310 320 330 340 350
FQTDFRVYLH LRQTWLAFMI ILSILEVIII LLLIFLRKRI LIAIALIKEA
360 370 380 390 400
SRAVGYVMCS LLYPLVTFFL LCLCIAYWAS TAVFLSTSNE AVYKIFDDSP
410 420 430 440 450
CPFTAKTCNP ETFPSSNESR QCPNARCQFA FYGGESGYHR ALLGLQIFNA
460 470 480 490 500
FMFFWLANFV LALGQVTLAG AFASYYWALR KPDDLPAFPL FSAFGRALRY
510 520 530 540 550
HTGSLAFGAL ILAIVQIIRV ILEYLDQRLK AAENKFAKCL MTCLKCCFWC
560 570 580 590 600
LEKFIKFLNR NAYIMIAIYG TNFCTSARNA FFLLMRNIIR VAVLDKVTDF
610 620 630 640 650
LFLLGKLLIV GSVGILAFFF FTHRIRIVQD TAPPLNYYWV PILTVIVGSY
660 670 680 690 700
LIAHGFFSVY GMCVDTLFLC FLEDLERNDG SAERPYFMSS TLKKLLNKTN

KKAAES
Length:706
Mass (Da):80,124
Last modified:November 2, 2010 - v3
Checksum:i9A044A531930326E
GO
Isoform 2 (identifier: Q8IWA5-2) [UniParc]FASTAAdd to Basket

Also known as: CTL2b, CTL2P2B

The sequence of this isoform differs from the canonical sequence as follows:
     672-706: LEDLERNDGSAERPYFMSSTLKKLLNKTNKKAAES → CEDLERNDGSQERPYFMSPELRDILLKGSAEEGKRAEAEE

Show »
Length:711
Mass (Da):80,737
Checksum:iFF8B042AFDEBA26C
GO
Isoform 3 (identifier: Q8IWA5-3) [UniParc]FASTAAdd to Basket

Also known as: CTL2P1

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MGDERPHYYGKH → MEDERKNGAY

Note: Produced by alternative promoter usage.

Show »
Length:704
Mass (Da):79,846
Checksum:i9B2CB6047E5FCDD6
GO

Sequence cautioni

The sequence BAC11662.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti92 – 921I → T in BAG51335. (PubMed:14702039)Curated
Sequence conflicti153 – 1531L → F in CBJ93592. 1 PublicationCurated
Sequence conflicti531 – 5311A → G in CAB75542. (PubMed:10677542)Curated
Sequence conflicti695 – 6951L → P in AAH40556. (PubMed:15489334)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti154 – 1541Q → R.6 Publications
Corresponds to variant rs2288904 [ dbSNP | Ensembl ].
VAR_023404

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1212MGDER…YYGKH → MEDERKNGAY in isoform 3. 2 PublicationsVSP_041792Add
BLAST
Alternative sequencei672 – 70635LEDLE…KAAES → CEDLERNDGSQERPYFMSPE LRDILLKGSAEEGKRAEAEE in isoform 2. 2 PublicationsVSP_015431Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ245621 Genomic DNA. Translation: CAB75542.1.
FN668568 mRNA. Translation: CBJ93592.1.
AK027519 mRNA. Translation: BAG51335.1.
AK294118 mRNA. Translation: BAG57451.1.
AK314582 mRNA. Translation: BAG37158.1.
AC011475 Genomic DNA. No translation available.
CH471106 Genomic DNA. Translation: EAW84126.1.
BC010617 mRNA. Translation: AAH10617.1.
BC040556 mRNA. Translation: AAH40556.1.
AL832517 mRNA. Translation: CAH56352.1.
AL832978 mRNA. Translation: CAH56342.1.
AK075512 mRNA. Translation: BAC11662.1. Different initiation.
AF070636 mRNA. No translation available.
CCDSiCCDS12245.1. [Q8IWA5-1]
CCDS54216.1. [Q8IWA5-3]
RefSeqiNP_001138528.1. NM_001145056.1. [Q8IWA5-3]
NP_065161.3. NM_020428.3. [Q8IWA5-1]
XP_005260054.1. XM_005259997.1. [Q8IWA5-2]
XP_005260055.1. XM_005259998.1. [Q8IWA5-2]
UniGeneiHs.534560.

Genome annotation databases

EnsembliENST00000335757; ENSP00000336888; ENSG00000129353. [Q8IWA5-1]
ENST00000407327; ENSP00000385135; ENSG00000129353. [Q8IWA5-3]
ENST00000586078; ENSP00000466664; ENSG00000129353. [Q8IWA5-2]
GeneIDi57153.
KEGGihsa:57153.
UCSCiuc002mpe.4. human. [Q8IWA5-3]
uc002mpf.3. human. [Q8IWA5-1]
uc002mpg.1. human. [Q8IWA5-2]

Polymorphism databases

DMDMi311033462.

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ245621 Genomic DNA. Translation: CAB75542.1 .
FN668568 mRNA. Translation: CBJ93592.1 .
AK027519 mRNA. Translation: BAG51335.1 .
AK294118 mRNA. Translation: BAG57451.1 .
AK314582 mRNA. Translation: BAG37158.1 .
AC011475 Genomic DNA. No translation available.
CH471106 Genomic DNA. Translation: EAW84126.1 .
BC010617 mRNA. Translation: AAH10617.1 .
BC040556 mRNA. Translation: AAH40556.1 .
AL832517 mRNA. Translation: CAH56352.1 .
AL832978 mRNA. Translation: CAH56342.1 .
AK075512 mRNA. Translation: BAC11662.1 . Different initiation.
AF070636 mRNA. No translation available.
CCDSi CCDS12245.1. [Q8IWA5-1 ]
CCDS54216.1. [Q8IWA5-3 ]
RefSeqi NP_001138528.1. NM_001145056.1. [Q8IWA5-3 ]
NP_065161.3. NM_020428.3. [Q8IWA5-1 ]
XP_005260054.1. XM_005259997.1. [Q8IWA5-2 ]
XP_005260055.1. XM_005259998.1. [Q8IWA5-2 ]
UniGenei Hs.534560.

3D structure databases

ProteinModelPortali Q8IWA5.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 121410. 3 interactions.
MINTi MINT-5006445.
STRINGi 9606.ENSP00000336888.

Chemistry

DrugBanki DB00122. Choline.

Protein family/group databases

TCDBi 2.A.92.1.4. the choline transporter-like (ctl) family.

PTM databases

PhosphoSitei Q8IWA5.

Polymorphism databases

DMDMi 311033462.

Proteomic databases

MaxQBi Q8IWA5.
PaxDbi Q8IWA5.
PeptideAtlasi Q8IWA5.
PRIDEi Q8IWA5.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000335757 ; ENSP00000336888 ; ENSG00000129353 . [Q8IWA5-1 ]
ENST00000407327 ; ENSP00000385135 ; ENSG00000129353 . [Q8IWA5-3 ]
ENST00000586078 ; ENSP00000466664 ; ENSG00000129353 . [Q8IWA5-2 ]
GeneIDi 57153.
KEGGi hsa:57153.
UCSCi uc002mpe.4. human. [Q8IWA5-3 ]
uc002mpf.3. human. [Q8IWA5-1 ]
uc002mpg.1. human. [Q8IWA5-2 ]

Organism-specific databases

CTDi 57153.
GeneCardsi GC19P010713.
H-InvDB HIX0202740.
HGNCi HGNC:17292. SLC44A2.
HPAi HPA003228.
MIMi 606106. gene.
neXtProti NX_Q8IWA5.
PharmGKBi PA142670899.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG310633.
GeneTreei ENSGT00550000074521.
HOVERGENi HBG062155.
InParanoidi Q8IWA5.
KOi K15377.
OMAi QTWMAFM.
OrthoDBi EOG7FR7G4.
PhylomeDBi Q8IWA5.
TreeFami TF313325.

Enzyme and pathway databases

Reactomei REACT_121238. Synthesis of PC.
REACT_19305. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.

Miscellaneous databases

ChiTaRSi SLC44A2. human.
GeneWikii SLC44A2.
GenomeRNAii 57153.
NextBioi 63129.
PROi Q8IWA5.
SOURCEi Search...

Gene expression databases

Bgeei Q8IWA5.
CleanExi HS_SLC44A2.
ExpressionAtlasi Q8IWA5. baseline and differential.
Genevestigatori Q8IWA5.

Family and domain databases

InterProi IPR007603. Choline_transptr-like.
[Graphical view ]
PANTHERi PTHR12385. PTHR12385. 1 hit.
Pfami PF04515. Choline_transpo. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "An electric lobe suppressor for a yeast choline transport mutation belongs to a new family of transporter-like proteins."
    O'Regan S., Traiffort E., Ruat M., Cha N., Compaore D., Meunier F.-M.
    Proc. Natl. Acad. Sci. U.S.A. 97:1835-1840(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 1), FUNCTION, VARIANT ARG-154.
  2. "Identification and characterization of choline transporter-like protein 2, an inner ear glycoprotein of 68 and 72 kDa that is the target of antibody-induced hearing loss."
    Nair T.S., Kozma K.E., Hoefling N.L., Kommareddi P.K., Ueda Y., Gong T.-W., Lomax M.I., Lansford C.D., Telian S.A., Satar B., Arts H.A., El-Kashlan H.K., Berryhill W.E., Raphael Y., Carey T.E.
    J. Neurosci. 24:1772-1779(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), DISEASE, TISSUE SPECIFICITY, VARIANT ARG-154.
    Tissue: Epithelium and Inner ear.
  3. "Detection of HNA-3b antibodies in patient sera."
    Santoso S.S., Bayat B.B., Sachs U.
    Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 565-706 (ISOFORM 2), VARIANT ARG-154.
    Tissue: Brain cortex, Placenta and Teratocarcinoma.
  5. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ARG-154.
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ARG-154.
    Tissue: Eye and Testis.
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 60-706 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 273-706 (ISOFORM 2), VARIANT ARG-154.
    Tissue: Stomach.
  9. "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries."
    Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y.
    , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.
    DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 321-706 (ISOFORM 1).
    Tissue: Embryo.
  10. Yu W., Gibbs R.A.
    Submitted (JUN-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 663-706 (ISOFORM 3).
  11. Cited for: INTERACTION WITH COCH.
  12. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
    Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
    J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-187 AND ASN-200.
    Tissue: Liver.
  13. "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
    Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
    Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-187 AND ASN-200.
    Tissue: Leukemic T-cell.
  14. "Isoforms, expression, glycosylation, and tissue distribution of CTL2/SLC44A2."
    Kommareddi P.K., Nair T.S., Thang L.V., Galano M.M., Babu E., Ganapathy V., Kanazawa T., McHugh J.B., Carey T.E.
    Protein J. 29:417-426(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, ALTERNATIVE PROMOTER USAGE, TISSUE SPECIFICITY.

Entry informationi

Entry nameiCTL2_HUMAN
AccessioniPrimary (citable) accession number: Q8IWA5
Secondary accession number(s): B2RBB1
, B3KNH3, B4DFJ0, F2Q9D7, Q658V1, Q658Z2, Q6PJV7, Q8N2F0, Q9NY68
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 30, 2005
Last sequence update: November 2, 2010
Last modified: October 29, 2014
This is version 108 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3