Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Choline transporter-like protein 2

Gene

SLC44A2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Isoform 1, but not isoform 3, exhibits some choline transporter activity.2 Publications

GO - Molecular functioni

  • choline transmembrane transporter activity Source: UniProtKB
  • signal transducer activity Source: UniProtKB

GO - Biological processi

  • choline transport Source: UniProtKB
  • phosphatidylcholine biosynthetic process Source: Reactome
  • positive regulation of I-kappaB kinase/NF-kappaB signaling Source: UniProtKB
  • transmembrane transport Source: Reactome
Complete GO annotation...

Keywords - Biological processi

Transport

Enzyme and pathway databases

ReactomeiR-HSA-1483191. Synthesis of PC.
R-HSA-425366. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.
R-HSA-6798695. Neutrophil degranulation.

Protein family/group databases

TCDBi2.A.92.1.4. the choline transporter-like (ctl) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Choline transporter-like protein 2
Alternative name(s):
Solute carrier family 44 member 2
Gene namesi
Name:SLC44A2
Synonyms:CTL2
ORF Names:PSEC0210
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:17292. SLC44A2.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 33CytoplasmicSequence analysisAdd BLAST33
Transmembranei34 – 54HelicalSequence analysisAdd BLAST21
Topological domaini55 – 232ExtracellularSequence analysisAdd BLAST178
Transmembranei233 – 253HelicalSequence analysisAdd BLAST21
Topological domaini254 – 256CytoplasmicSequence analysis3
Transmembranei257 – 277HelicalSequence analysisAdd BLAST21
Topological domaini278 – 315ExtracellularSequence analysisAdd BLAST38
Transmembranei316 – 336HelicalSequence analysisAdd BLAST21
Topological domaini337 – 364CytoplasmicSequence analysisAdd BLAST28
Transmembranei365 – 385HelicalSequence analysisAdd BLAST21
Topological domaini386 – 457ExtracellularSequence analysisAdd BLAST72
Transmembranei458 – 480HelicalSequence analysisAdd BLAST23
Topological domaini481 – 504CytoplasmicSequence analysisAdd BLAST24
Transmembranei505 – 525HelicalSequence analysisAdd BLAST21
Topological domaini526 – 563ExtracellularSequence analysisAdd BLAST38
Transmembranei564 – 584HelicalSequence analysisAdd BLAST21
Topological domaini585 – 599CytoplasmicSequence analysisAdd BLAST15
Transmembranei600 – 620HelicalSequence analysisAdd BLAST21
Topological domaini621 – 638ExtracellularSequence analysisAdd BLAST18
Transmembranei639 – 659HelicalSequence analysisAdd BLAST21
Topological domaini660 – 706CytoplasmicSequence analysisAdd BLAST47

GO - Cellular componenti

  • extracellular exosome Source: UniProtKB
  • integral component of membrane Source: UniProtKB
  • lysosomal membrane Source: UniProtKB
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi57153.
OpenTargetsiENSG00000129353.
PharmGKBiPA142670899.

Chemistry databases

DrugBankiDB00122. Choline.

Polymorphism and mutation databases

BioMutaiSLC44A2.
DMDMi311033462.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001917171 – 706Choline transporter-like protein 2Add BLAST706

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei14PhosphothreonineCombined sources1
Glycosylationi187N-linked (GlcNAc...)2 Publications1
Glycosylationi200N-linked (GlcNAc...)2 Publications1
Glycosylationi417N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ8IWA5.
PaxDbiQ8IWA5.
PeptideAtlasiQ8IWA5.
PRIDEiQ8IWA5.

PTM databases

iPTMnetiQ8IWA5.
PhosphoSitePlusiQ8IWA5.
SwissPalmiQ8IWA5.

Expressioni

Tissue specificityi

Present in supporting cells of the inner ear (at protein level). Only isoform 3 is expressed in inner ear vestibular tissue.2 Publications

Gene expression databases

BgeeiENSG00000129353.
CleanExiHS_SLC44A2.
ExpressionAtlasiQ8IWA5. baseline and differential.
GenevisibleiQ8IWA5. HS.

Organism-specific databases

HPAiHPA003228.

Interactioni

Subunit structurei

Interacts with COCH.1 Publication

Protein-protein interaction databases

BioGridi121410. 1 interactor.
IntActiQ8IWA5. 1 interactor.
MINTiMINT-5006445.
STRINGi9606.ENSP00000336888.

Structurei

3D structure databases

ProteinModelPortaliQ8IWA5.
SMRiQ8IWA5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1362. Eukaryota.
ENOG410XS0P. LUCA.
GeneTreeiENSGT00550000074521.
HOVERGENiHBG062155.
InParanoidiQ8IWA5.
KOiK15377.
OMAiQHYYGKH.
OrthoDBiEOG091G04CQ.
PhylomeDBiQ8IWA5.
TreeFamiTF313325.

Family and domain databases

InterProiIPR007603. Choline_transptr-like.
[Graphical view]
PANTHERiPTHR12385. PTHR12385. 2 hits.
PfamiPF04515. Choline_transpo. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8IWA5-1) [UniParc]FASTAAdd to basket
Also known as: CTL2a, CTL2P2A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGDERPHYYG KHGTPQKYDP TFKGPIYNRG CTDIICCVFL LLAIVGYVAV
60 70 80 90 100
GIIAWTHGDP RKVIYPTDSR GEFCGQKGTK NENKPYLFYF NIVKCASPLV
110 120 130 140 150
LLEFQCPTPQ ICVEKCPDRY LTYLNARSSR DFEYYKQFCV PGFKNNKGVA
160 170 180 190 200
EVLQDGDCPA VLIPSKPLAR RCFPAIHAYK GVLMVGNETT YEDGHGSRKN
210 220 230 240 250
ITDLVEGAKK ANGVLEARQL AMRIFEDYTV SWYWIIIGLV IAMAMSLLFI
260 270 280 290 300
ILLRFLAGIM VWVMIIMVIL VLGYGIFHCY MEYSRLRGEA GSDVSLVDLG
310 320 330 340 350
FQTDFRVYLH LRQTWLAFMI ILSILEVIII LLLIFLRKRI LIAIALIKEA
360 370 380 390 400
SRAVGYVMCS LLYPLVTFFL LCLCIAYWAS TAVFLSTSNE AVYKIFDDSP
410 420 430 440 450
CPFTAKTCNP ETFPSSNESR QCPNARCQFA FYGGESGYHR ALLGLQIFNA
460 470 480 490 500
FMFFWLANFV LALGQVTLAG AFASYYWALR KPDDLPAFPL FSAFGRALRY
510 520 530 540 550
HTGSLAFGAL ILAIVQIIRV ILEYLDQRLK AAENKFAKCL MTCLKCCFWC
560 570 580 590 600
LEKFIKFLNR NAYIMIAIYG TNFCTSARNA FFLLMRNIIR VAVLDKVTDF
610 620 630 640 650
LFLLGKLLIV GSVGILAFFF FTHRIRIVQD TAPPLNYYWV PILTVIVGSY
660 670 680 690 700
LIAHGFFSVY GMCVDTLFLC FLEDLERNDG SAERPYFMSS TLKKLLNKTN

KKAAES
Length:706
Mass (Da):80,124
Last modified:November 2, 2010 - v3
Checksum:i9A044A531930326E
GO
Isoform 2 (identifier: Q8IWA5-2) [UniParc]FASTAAdd to basket
Also known as: CTL2b, CTL2P2B

The sequence of this isoform differs from the canonical sequence as follows:
     672-706: LEDLERNDGSAERPYFMSSTLKKLLNKTNKKAAES → CEDLERNDGSQERPYFMSPELRDILLKGSAEEGKRAEAEE

Show »
Length:711
Mass (Da):80,737
Checksum:iFF8B042AFDEBA26C
GO
Isoform 3 (identifier: Q8IWA5-3) [UniParc]FASTAAdd to basket
Also known as: CTL2P1

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MGDERPHYYGKH → MEDERKNGAY

Note: Produced by alternative promoter usage.
Show »
Length:704
Mass (Da):79,846
Checksum:i9B2CB6047E5FCDD6
GO

Sequence cautioni

The sequence BAC11662 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti92I → T in BAG51335 (PubMed:14702039).Curated1
Sequence conflicti153L → F in CBJ93592 (Ref. 3) Curated1
Sequence conflicti531A → G in CAB75542 (PubMed:10677542).Curated1
Sequence conflicti695L → P in AAH40556 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_023404154Q → R.6 PublicationsCorresponds to variant rs2288904dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0417921 – 12MGDER…YYGKH → MEDERKNGAY in isoform 3. 2 PublicationsAdd BLAST12
Alternative sequenceiVSP_015431672 – 706LEDLE…KAAES → CEDLERNDGSQERPYFMSPE LRDILLKGSAEEGKRAEAEE in isoform 2. 2 PublicationsAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ245621 Genomic DNA. Translation: CAB75542.1.
FN668568 mRNA. Translation: CBJ93592.1.
AK027519 mRNA. Translation: BAG51335.1.
AK294118 mRNA. Translation: BAG57451.1.
AK314582 mRNA. Translation: BAG37158.1.
AC011475 Genomic DNA. No translation available.
CH471106 Genomic DNA. Translation: EAW84126.1.
BC010617 mRNA. Translation: AAH10617.1.
BC040556 mRNA. Translation: AAH40556.1.
AL832517 mRNA. Translation: CAH56352.1.
AL832978 mRNA. Translation: CAH56342.1.
AK075512 mRNA. Translation: BAC11662.1. Different initiation.
AF070636 mRNA. No translation available.
CCDSiCCDS12245.1. [Q8IWA5-1]
CCDS54216.1. [Q8IWA5-3]
RefSeqiNP_001138528.1. NM_001145056.1. [Q8IWA5-3]
NP_065161.3. NM_020428.3. [Q8IWA5-1]
XP_005260054.1. XM_005259997.1. [Q8IWA5-2]
UniGeneiHs.534560.

Genome annotation databases

EnsembliENST00000335757; ENSP00000336888; ENSG00000129353. [Q8IWA5-1]
ENST00000407327; ENSP00000385135; ENSG00000129353. [Q8IWA5-3]
ENST00000586078; ENSP00000466664; ENSG00000129353. [Q8IWA5-2]
GeneIDi57153.
KEGGihsa:57153.
UCSCiuc002mpe.5. human. [Q8IWA5-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ245621 Genomic DNA. Translation: CAB75542.1.
FN668568 mRNA. Translation: CBJ93592.1.
AK027519 mRNA. Translation: BAG51335.1.
AK294118 mRNA. Translation: BAG57451.1.
AK314582 mRNA. Translation: BAG37158.1.
AC011475 Genomic DNA. No translation available.
CH471106 Genomic DNA. Translation: EAW84126.1.
BC010617 mRNA. Translation: AAH10617.1.
BC040556 mRNA. Translation: AAH40556.1.
AL832517 mRNA. Translation: CAH56352.1.
AL832978 mRNA. Translation: CAH56342.1.
AK075512 mRNA. Translation: BAC11662.1. Different initiation.
AF070636 mRNA. No translation available.
CCDSiCCDS12245.1. [Q8IWA5-1]
CCDS54216.1. [Q8IWA5-3]
RefSeqiNP_001138528.1. NM_001145056.1. [Q8IWA5-3]
NP_065161.3. NM_020428.3. [Q8IWA5-1]
XP_005260054.1. XM_005259997.1. [Q8IWA5-2]
UniGeneiHs.534560.

3D structure databases

ProteinModelPortaliQ8IWA5.
SMRiQ8IWA5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121410. 1 interactor.
IntActiQ8IWA5. 1 interactor.
MINTiMINT-5006445.
STRINGi9606.ENSP00000336888.

Chemistry databases

DrugBankiDB00122. Choline.

Protein family/group databases

TCDBi2.A.92.1.4. the choline transporter-like (ctl) family.

PTM databases

iPTMnetiQ8IWA5.
PhosphoSitePlusiQ8IWA5.
SwissPalmiQ8IWA5.

Polymorphism and mutation databases

BioMutaiSLC44A2.
DMDMi311033462.

Proteomic databases

MaxQBiQ8IWA5.
PaxDbiQ8IWA5.
PeptideAtlasiQ8IWA5.
PRIDEiQ8IWA5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000335757; ENSP00000336888; ENSG00000129353. [Q8IWA5-1]
ENST00000407327; ENSP00000385135; ENSG00000129353. [Q8IWA5-3]
ENST00000586078; ENSP00000466664; ENSG00000129353. [Q8IWA5-2]
GeneIDi57153.
KEGGihsa:57153.
UCSCiuc002mpe.5. human. [Q8IWA5-1]

Organism-specific databases

CTDi57153.
DisGeNETi57153.
GeneCardsiSLC44A2.
H-InvDBHIX0202740.
HGNCiHGNC:17292. SLC44A2.
HPAiHPA003228.
MIMi606106. gene.
neXtProtiNX_Q8IWA5.
OpenTargetsiENSG00000129353.
PharmGKBiPA142670899.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1362. Eukaryota.
ENOG410XS0P. LUCA.
GeneTreeiENSGT00550000074521.
HOVERGENiHBG062155.
InParanoidiQ8IWA5.
KOiK15377.
OMAiQHYYGKH.
OrthoDBiEOG091G04CQ.
PhylomeDBiQ8IWA5.
TreeFamiTF313325.

Enzyme and pathway databases

ReactomeiR-HSA-1483191. Synthesis of PC.
R-HSA-425366. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.
R-HSA-6798695. Neutrophil degranulation.

Miscellaneous databases

ChiTaRSiSLC44A2. human.
GeneWikiiSLC44A2.
GenomeRNAii57153.
PROiQ8IWA5.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000129353.
CleanExiHS_SLC44A2.
ExpressionAtlasiQ8IWA5. baseline and differential.
GenevisibleiQ8IWA5. HS.

Family and domain databases

InterProiIPR007603. Choline_transptr-like.
[Graphical view]
PANTHERiPTHR12385. PTHR12385. 2 hits.
PfamiPF04515. Choline_transpo. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCTL2_HUMAN
AccessioniPrimary (citable) accession number: Q8IWA5
Secondary accession number(s): B2RBB1
, B3KNH3, B4DFJ0, F2Q9D7, Q658V1, Q658Z2, Q6PJV7, Q8N2F0, Q9NY68
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 30, 2005
Last sequence update: November 2, 2010
Last modified: November 30, 2016
This is version 125 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.