SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8IWA5

- CTL2_HUMAN

UniProt

Q8IWA5 - CTL2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Choline transporter-like protein 2
Gene
SLC44A2, CTL2, PSEC0210
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Isoform 1, but not isoform 3, exhibits some choline transporter activity.2 Publications

GO - Molecular functioni

  1. choline transmembrane transporter activity Source: UniProtKB
  2. signal transducer activity Source: UniProtKB
Complete GO annotation...

GO - Biological processi

  1. choline transport Source: UniProtKB
  2. glycerophospholipid biosynthetic process Source: Reactome
  3. phosphatidylcholine biosynthetic process Source: Reactome
  4. phospholipid metabolic process Source: Reactome
  5. positive regulation of I-kappaB kinase/NF-kappaB signaling Source: UniProtKB
  6. signal transduction Source: GOC
  7. small molecule metabolic process Source: Reactome
  8. transmembrane transport Source: Reactome
Complete GO annotation...

Keywords - Biological processi

Transport

Enzyme and pathway databases

ReactomeiREACT_121238. Synthesis of PC.
REACT_19305. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.

Protein family/group databases

TCDBi2.A.92.1.4. the choline transporter-like (ctl) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Choline transporter-like protein 2
Alternative name(s):
Solute carrier family 44 member 2
Gene namesi
Name:SLC44A2
Synonyms:CTL2
ORF Names:PSEC0210
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:17292. SLC44A2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 3333Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei34 – 5421Helical; Reviewed prediction
Add
BLAST
Topological domaini55 – 232178Extracellular Reviewed prediction
Add
BLAST
Transmembranei233 – 25321Helical; Reviewed prediction
Add
BLAST
Topological domaini254 – 2563Cytoplasmic Reviewed prediction
Transmembranei257 – 27721Helical; Reviewed prediction
Add
BLAST
Topological domaini278 – 31538Extracellular Reviewed prediction
Add
BLAST
Transmembranei316 – 33621Helical; Reviewed prediction
Add
BLAST
Topological domaini337 – 36428Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei365 – 38521Helical; Reviewed prediction
Add
BLAST
Topological domaini386 – 45772Extracellular Reviewed prediction
Add
BLAST
Transmembranei458 – 48023Helical; Reviewed prediction
Add
BLAST
Topological domaini481 – 50424Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei505 – 52521Helical; Reviewed prediction
Add
BLAST
Topological domaini526 – 56338Extracellular Reviewed prediction
Add
BLAST
Transmembranei564 – 58421Helical; Reviewed prediction
Add
BLAST
Topological domaini585 – 59915Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei600 – 62021Helical; Reviewed prediction
Add
BLAST
Topological domaini621 – 63818Extracellular Reviewed prediction
Add
BLAST
Transmembranei639 – 65921Helical; Reviewed prediction
Add
BLAST
Topological domaini660 – 70647Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. extracellular vesicular exosome Source: UniProt
  2. integral component of membrane Source: UniProtKB
  3. lysosomal membrane Source: UniProtKB
  4. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142670899.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 706706Choline transporter-like protein 2
PRO_0000191717Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi187 – 1871N-linked (GlcNAc...)2 Publications
Glycosylationi200 – 2001N-linked (GlcNAc...)2 Publications
Glycosylationi417 – 4171N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ8IWA5.
PaxDbiQ8IWA5.
PeptideAtlasiQ8IWA5.
PRIDEiQ8IWA5.

PTM databases

PhosphoSiteiQ8IWA5.

Expressioni

Tissue specificityi

Present in supporting cells of the inner ear (at protein level). Only isoform 3 is expressed in inner ear vestibular tissue.2 Publications

Gene expression databases

ArrayExpressiQ8IWA5.
BgeeiQ8IWA5.
CleanExiHS_SLC44A2.
GenevestigatoriQ8IWA5.

Organism-specific databases

HPAiHPA003228.

Interactioni

Subunit structurei

Interacts with COCH.1 Publication

Protein-protein interaction databases

BioGridi121410. 2 interactions.
MINTiMINT-5006445.
STRINGi9606.ENSP00000336888.

Structurei

3D structure databases

ProteinModelPortaliQ8IWA5.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG310633.
HOVERGENiHBG062155.
InParanoidiQ8IWA5.
KOiK15377.
OMAiQTWMAFM.
OrthoDBiEOG7FR7G4.
PhylomeDBiQ8IWA5.
TreeFamiTF313325.

Family and domain databases

InterProiIPR007603. Choline_transptr-like.
[Graphical view]
PANTHERiPTHR12385. PTHR12385. 1 hit.
PfamiPF04515. Choline_transpo. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative promoter usage and alternative splicing. Align

Isoform 1 (identifier: Q8IWA5-1) [UniParc]FASTAAdd to Basket

Also known as: CTL2a, CTL2P2A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGDERPHYYG KHGTPQKYDP TFKGPIYNRG CTDIICCVFL LLAIVGYVAV    50
GIIAWTHGDP RKVIYPTDSR GEFCGQKGTK NENKPYLFYF NIVKCASPLV 100
LLEFQCPTPQ ICVEKCPDRY LTYLNARSSR DFEYYKQFCV PGFKNNKGVA 150
EVLQDGDCPA VLIPSKPLAR RCFPAIHAYK GVLMVGNETT YEDGHGSRKN 200
ITDLVEGAKK ANGVLEARQL AMRIFEDYTV SWYWIIIGLV IAMAMSLLFI 250
ILLRFLAGIM VWVMIIMVIL VLGYGIFHCY MEYSRLRGEA GSDVSLVDLG 300
FQTDFRVYLH LRQTWLAFMI ILSILEVIII LLLIFLRKRI LIAIALIKEA 350
SRAVGYVMCS LLYPLVTFFL LCLCIAYWAS TAVFLSTSNE AVYKIFDDSP 400
CPFTAKTCNP ETFPSSNESR QCPNARCQFA FYGGESGYHR ALLGLQIFNA 450
FMFFWLANFV LALGQVTLAG AFASYYWALR KPDDLPAFPL FSAFGRALRY 500
HTGSLAFGAL ILAIVQIIRV ILEYLDQRLK AAENKFAKCL MTCLKCCFWC 550
LEKFIKFLNR NAYIMIAIYG TNFCTSARNA FFLLMRNIIR VAVLDKVTDF 600
LFLLGKLLIV GSVGILAFFF FTHRIRIVQD TAPPLNYYWV PILTVIVGSY 650
LIAHGFFSVY GMCVDTLFLC FLEDLERNDG SAERPYFMSS TLKKLLNKTN 700
KKAAES 706
Length:706
Mass (Da):80,124
Last modified:November 2, 2010 - v3
Checksum:i9A044A531930326E
GO
Isoform 2 (identifier: Q8IWA5-2) [UniParc]FASTAAdd to Basket

Also known as: CTL2b, CTL2P2B

The sequence of this isoform differs from the canonical sequence as follows:
     672-706: LEDLERNDGSAERPYFMSSTLKKLLNKTNKKAAES → CEDLERNDGSQERPYFMSPELRDILLKGSAEEGKRAEAEE

Show »
Length:711
Mass (Da):80,737
Checksum:iFF8B042AFDEBA26C
GO
Isoform 3 (identifier: Q8IWA5-3) [UniParc]FASTAAdd to Basket

Also known as: CTL2P1

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MGDERPHYYGKH → MEDERKNGAY

Note: Produced by alternative promoter usage.

Show »
Length:704
Mass (Da):79,846
Checksum:i9B2CB6047E5FCDD6
GO

Sequence cautioni

The sequence BAC11662.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti154 – 1541Q → R.6 Publications
Corresponds to variant rs2288904 [ dbSNP | Ensembl ].
VAR_023404

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1212MGDER…YYGKH → MEDERKNGAY in isoform 3.
VSP_041792Add
BLAST
Alternative sequencei672 – 70635LEDLE…KAAES → CEDLERNDGSQERPYFMSPE LRDILLKGSAEEGKRAEAEE in isoform 2.
VSP_015431Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti92 – 921I → T in BAG51335. 1 Publication
Sequence conflicti153 – 1531L → F in CBJ93592. 1 Publication
Sequence conflicti531 – 5311A → G in CAB75542. 1 Publication
Sequence conflicti695 – 6951L → P in AAH40556. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ245621 Genomic DNA. Translation: CAB75542.1.
FN668568 mRNA. Translation: CBJ93592.1.
AK027519 mRNA. Translation: BAG51335.1.
AK294118 mRNA. Translation: BAG57451.1.
AK314582 mRNA. Translation: BAG37158.1.
AC011475 Genomic DNA. No translation available.
CH471106 Genomic DNA. Translation: EAW84126.1.
BC010617 mRNA. Translation: AAH10617.1.
BC040556 mRNA. Translation: AAH40556.1.
AL832517 mRNA. Translation: CAH56352.1.
AL832978 mRNA. Translation: CAH56342.1.
AK075512 mRNA. Translation: BAC11662.1. Different initiation.
AF070636 mRNA. No translation available.
CCDSiCCDS12245.1. [Q8IWA5-1]
CCDS54216.1. [Q8IWA5-3]
RefSeqiNP_001138528.1. NM_001145056.1. [Q8IWA5-3]
NP_065161.3. NM_020428.3. [Q8IWA5-1]
XP_005260054.1. XM_005259997.1. [Q8IWA5-2]
XP_005260055.1. XM_005259998.1. [Q8IWA5-2]
UniGeneiHs.534560.

Genome annotation databases

EnsembliENST00000335757; ENSP00000336888; ENSG00000129353. [Q8IWA5-1]
ENST00000407327; ENSP00000385135; ENSG00000129353. [Q8IWA5-3]
ENST00000586078; ENSP00000466664; ENSG00000129353. [Q8IWA5-2]
GeneIDi57153.
KEGGihsa:57153.
UCSCiuc002mpe.4. human. [Q8IWA5-3]
uc002mpf.3. human. [Q8IWA5-1]
uc002mpg.1. human. [Q8IWA5-2]

Polymorphism databases

DMDMi311033462.

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ245621 Genomic DNA. Translation: CAB75542.1 .
FN668568 mRNA. Translation: CBJ93592.1 .
AK027519 mRNA. Translation: BAG51335.1 .
AK294118 mRNA. Translation: BAG57451.1 .
AK314582 mRNA. Translation: BAG37158.1 .
AC011475 Genomic DNA. No translation available.
CH471106 Genomic DNA. Translation: EAW84126.1 .
BC010617 mRNA. Translation: AAH10617.1 .
BC040556 mRNA. Translation: AAH40556.1 .
AL832517 mRNA. Translation: CAH56352.1 .
AL832978 mRNA. Translation: CAH56342.1 .
AK075512 mRNA. Translation: BAC11662.1 . Different initiation.
AF070636 mRNA. No translation available.
CCDSi CCDS12245.1. [Q8IWA5-1 ]
CCDS54216.1. [Q8IWA5-3 ]
RefSeqi NP_001138528.1. NM_001145056.1. [Q8IWA5-3 ]
NP_065161.3. NM_020428.3. [Q8IWA5-1 ]
XP_005260054.1. XM_005259997.1. [Q8IWA5-2 ]
XP_005260055.1. XM_005259998.1. [Q8IWA5-2 ]
UniGenei Hs.534560.

3D structure databases

ProteinModelPortali Q8IWA5.
ModBasei Search...

Protein-protein interaction databases

BioGridi 121410. 2 interactions.
MINTi MINT-5006445.
STRINGi 9606.ENSP00000336888.

Chemistry

DrugBanki DB00122. Choline.

Protein family/group databases

TCDBi 2.A.92.1.4. the choline transporter-like (ctl) family.

PTM databases

PhosphoSitei Q8IWA5.

Polymorphism databases

DMDMi 311033462.

Proteomic databases

MaxQBi Q8IWA5.
PaxDbi Q8IWA5.
PeptideAtlasi Q8IWA5.
PRIDEi Q8IWA5.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000335757 ; ENSP00000336888 ; ENSG00000129353 . [Q8IWA5-1 ]
ENST00000407327 ; ENSP00000385135 ; ENSG00000129353 . [Q8IWA5-3 ]
ENST00000586078 ; ENSP00000466664 ; ENSG00000129353 . [Q8IWA5-2 ]
GeneIDi 57153.
KEGGi hsa:57153.
UCSCi uc002mpe.4. human. [Q8IWA5-3 ]
uc002mpf.3. human. [Q8IWA5-1 ]
uc002mpg.1. human. [Q8IWA5-2 ]

Organism-specific databases

CTDi 57153.
GeneCardsi GC19P010713.
H-InvDB HIX0202740.
HGNCi HGNC:17292. SLC44A2.
HPAi HPA003228.
MIMi 606106. gene.
neXtProti NX_Q8IWA5.
PharmGKBi PA142670899.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG310633.
HOVERGENi HBG062155.
InParanoidi Q8IWA5.
KOi K15377.
OMAi QTWMAFM.
OrthoDBi EOG7FR7G4.
PhylomeDBi Q8IWA5.
TreeFami TF313325.

Enzyme and pathway databases

Reactomei REACT_121238. Synthesis of PC.
REACT_19305. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.

Miscellaneous databases

ChiTaRSi SLC44A2. human.
GeneWikii SLC44A2.
GenomeRNAii 57153.
NextBioi 63129.
PROi Q8IWA5.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q8IWA5.
Bgeei Q8IWA5.
CleanExi HS_SLC44A2.
Genevestigatori Q8IWA5.

Family and domain databases

InterProi IPR007603. Choline_transptr-like.
[Graphical view ]
PANTHERi PTHR12385. PTHR12385. 1 hit.
Pfami PF04515. Choline_transpo. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "An electric lobe suppressor for a yeast choline transport mutation belongs to a new family of transporter-like proteins."
    O'Regan S., Traiffort E., Ruat M., Cha N., Compaore D., Meunier F.-M.
    Proc. Natl. Acad. Sci. U.S.A. 97:1835-1840(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 1), FUNCTION, VARIANT ARG-154.
  2. "Identification and characterization of choline transporter-like protein 2, an inner ear glycoprotein of 68 and 72 kDa that is the target of antibody-induced hearing loss."
    Nair T.S., Kozma K.E., Hoefling N.L., Kommareddi P.K., Ueda Y., Gong T.-W., Lomax M.I., Lansford C.D., Telian S.A., Satar B., Arts H.A., El-Kashlan H.K., Berryhill W.E., Raphael Y., Carey T.E.
    J. Neurosci. 24:1772-1779(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), DISEASE, TISSUE SPECIFICITY, VARIANT ARG-154.
    Tissue: Epithelium and Inner ear.
  3. "Detection of HNA-3b antibodies in patient sera."
    Santoso S.S., Bayat B.B., Sachs U.
    Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 565-706 (ISOFORM 2), VARIANT ARG-154.
    Tissue: Brain cortex, Placenta and Teratocarcinoma.
  5. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ARG-154.
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ARG-154.
    Tissue: Eye and Testis.
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 60-706 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 273-706 (ISOFORM 2), VARIANT ARG-154.
    Tissue: Stomach.
  9. "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries."
    Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y.
    , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.
    DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 321-706 (ISOFORM 1).
    Tissue: Embryo.
  10. Yu W., Gibbs R.A.
    Submitted (JUN-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 663-706 (ISOFORM 3).
  11. Cited for: INTERACTION WITH COCH.
  12. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
    Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
    J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-187 AND ASN-200.
    Tissue: Liver.
  13. "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
    Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
    Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-187 AND ASN-200.
    Tissue: Leukemic T-cell.
  14. "Isoforms, expression, glycosylation, and tissue distribution of CTL2/SLC44A2."
    Kommareddi P.K., Nair T.S., Thang L.V., Galano M.M., Babu E., Ganapathy V., Kanazawa T., McHugh J.B., Carey T.E.
    Protein J. 29:417-426(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, ALTERNATIVE PROMOTER USAGE, TISSUE SPECIFICITY.

Entry informationi

Entry nameiCTL2_HUMAN
AccessioniPrimary (citable) accession number: Q8IWA5
Secondary accession number(s): B2RBB1
, B3KNH3, B4DFJ0, F2Q9D7, Q658V1, Q658Z2, Q6PJV7, Q8N2F0, Q9NY68
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 30, 2005
Last sequence update: November 2, 2010
Last modified: September 3, 2014
This is version 106 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi