Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nostrin

Gene

NOSTRIN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Multivalent adapter protein which may decrease NOS3 activity by inducing its translocation away from the plasma membrane.3 Publications

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processEndocytosis

Enzyme and pathway databases

ReactomeiR-HSA-203641 NOSTRIN mediated eNOS trafficking

Names & Taxonomyi

Protein namesi
Recommended name:
Nostrin
Alternative name(s):
BM247 homolog
Nitric oxide synthase traffic inducer
Nitric oxide synthase trafficker
eNOS-trafficking inducer
Gene namesi
Name:NOSTRIN
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi

Organism-specific databases

EuPathDBiHostDB:ENSG00000163072.14
HGNCiHGNC:20203 NOSTRIN
MIMi607496 gene
neXtProtiNX_Q8IVI9

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Membrane, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi115677
OpenTargetsiENSG00000163072
PharmGKBiPA134992787

Polymorphism and mutation databases

BioMutaiNOSTRIN
DMDMi317373401

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002890891 – 506NostrinAdd BLAST506

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei114PhosphoserineBy similarity1
Modified residuei479PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8IVI9
PeptideAtlasiQ8IVI9
PRIDEiQ8IVI9

PTM databases

iPTMnetiQ8IVI9
PhosphoSitePlusiQ8IVI9

Expressioni

Tissue specificityi

Expressed at highest levels in heart, kidney, placenta and lung, and at lowest levels in brain, thymus and spleen. Present in vascular endothelial cells and placenta. Over-expressed in placenta from women with pre-eclampsia (at protein level).2 Publications

Gene expression databases

BgeeiENSG00000163072
CleanExiHS_NOSTRIN
ExpressionAtlasiQ8IVI9 baseline and differential
GenevisibleiQ8IVI9 HS

Organism-specific databases

HPAiHPA044384

Interactioni

Subunit structurei

Homotrimer. Interacts with DAB2 (By similarity). Interacts with NOS3, DNM2, WASL and CAV1.By similarity3 Publications

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi125446, 4 interactors
CORUMiQ8IVI9
IntActiQ8IVI9, 15 interactors
MINTiQ8IVI9

Structurei

Secondary structure

1506
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi441 – 447Combined sources7
Beta strandi464 – 469Combined sources6
Beta strandi472 – 474Combined sources3
Beta strandi476 – 482Combined sources7
Beta strandi484 – 487Combined sources4
Beta strandi492 – 497Combined sources6

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2YUNNMR-A441-506[»]
ProteinModelPortaliQ8IVI9
SMRiQ8IVI9
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8IVI9

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 260F-BARPROSITE-ProRule annotationAdd BLAST260
Domaini292 – 372REM-1PROSITE-ProRule annotationAdd BLAST81
Domaini438 – 497SH3PROSITE-ProRule annotationAdd BLAST60

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili160 – 222Sequence analysisAdd BLAST63

Domaini

The SH3 domain mediates interaction with NOS3, DNM2 and WASL.
The F-BAR domain is necessary for membrane targeting.

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

GeneTreeiENSGT00510000048120
HOGENOMiHOG000113830
HOVERGENiHBG101730
InParanoidiQ8IVI9
KOiK20126
OMAiTYQVLNV
OrthoDBiEOG091G01QT
PhylomeDBiQ8IVI9

Family and domain databases

CDDicd11823 SH3_Nostrin, 1 hit
Gene3Di1.20.1270.60, 1 hit
InterProiView protein in InterPro
IPR027267 AH/BAR_dom_sf
IPR031160 F_BAR
IPR001060 FCH_dom
IPR036274 HR1_rpt_sf
IPR028535 Nostrin
IPR035656 Nostrin_SH3
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PANTHERiPTHR14167:SF31 PTHR14167:SF31, 1 hit
PfamiView protein in Pfam
PF00611 FCH, 1 hit
PF14604 SH3_9, 1 hit
PRINTSiPR00452 SH3DOMAIN
SMARTiView protein in SMART
SM00326 SH3, 1 hit
SUPFAMiSSF103657 SSF103657, 1 hit
SSF46585 SSF46585, 1 hit
SSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS51741 F_BAR, 1 hit
PS51860 REM_1, 1 hit
PS50002 SH3, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8IVI9-1) [UniParc]FASTAAdd to basket
Also known as: NOSTRINalpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRDPLTDCPY NKVYKNLKEF SQNGENFCKQ VTSVLQQRAN LEISYAKGLQ
60 70 80 90 100
KLASKLSKAL QNTRKSCVSS AWAWASEGMK STADLHQKLG KAIELEAIKP
110 120 130 140 150
TYQVLNVQEK KRKSLDNEVE KTANLVISNW NQQIKAKKKL MVSTKKHEAL
160 170 180 190 200
FQLVESSKQS MTEKEKRKLL NKLTKSTEKL EKEDENYYQK NMAGYSTRLK
210 220 230 240 250
WENTLENCYQ SILELEKERI QLLCNNLNQY SQHISLFGQT LTTCHTQIHC
260 270 280 290 300
AISKIDIEKD IQAVMEETAI LSTENKSEFL LTDYFEEDPN SAMDKERRKS
310 320 330 340 350
LLKPKLLRLQ RDIEKASKDK EGLERMLKTY SSTSSFSDAK SQKDTAALMD
360 370 380 390 400
ENNLKLDLLE ANSYKLSSML AELEQRPQPS HPCSNSIFRW REKEHTHSYV
410 420 430 440 450
KISRPFLMKR LENIVSKASS GGQSNPGSST PAPGAAQLSS RLCKALYSFQ
460 470 480 490 500
ARQDDELNLE KGDIVIIHEK KEGGWWFGSL NGKKGHFPAA YVEELPSNAG

NTATKA
Length:506
Mass (Da):57,660
Last modified:January 11, 2011 - v2
Checksum:iDC9A6DF5B9C2AED0
GO
Isoform 2 (identifier: Q8IVI9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     38-65: Missing.

Show »
Length:478
Mass (Da):54,547
Checksum:iE8E6E3B37569F432
GO
Isoform 3 (identifier: Q8IVI9-3) [UniParc]FASTAAdd to basket
Also known as: NOSTRINbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-78: Missing.

Note: May negatively regulate transcription of the NOSTRIN gene.1 Publication
Show »
Length:428
Mass (Da):48,876
Checksum:i8819706D71DAC60C
GO
Isoform 4 (identifier: Q8IVI9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     209-209: Y → YQVTHSICLYAFWVKRAWGKCVSDLRYQDTFLPGNLPPLWFGYDIVKRLIMRLCSVCL

Note: No experimental confirmation available.Curated
Show »
Length:563
Mass (Da):64,364
Checksum:i6FE667B285DD4D54
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti225N → D in BAG52717 (PubMed:14702039).Curated1
Isoform 4 (identifier: Q8IVI9-4)
Sequence conflicti238T → I in BAG52717 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_032569473G → E4 PublicationsCorresponds to variant dbSNP:rs479661Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0258841 – 78Missing in isoform 3. 1 PublicationAdd BLAST78
Alternative sequenceiVSP_02588538 – 65Missing in isoform 2. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_044995209Y → YQVTHSICLYAFWVKRAWGK CVSDLRYQDTFLPGNLPPLW FGYDIVKRLIMRLCSVCL in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ532842 mRNA Translation: CAD58724.1
DQ402497 mRNA Translation: ABD62889.1
AK002203 mRNA Translation: BAE46614.1
AK093444 mRNA Translation: BAG52717.1
AK290254 mRNA Translation: BAF82943.1
AC069137 Genomic DNA Translation: AAY24097.1
AC009475 Genomic DNA No translation available.
BC014189 mRNA Translation: AAH14189.1
BC093072 mRNA Translation: AAH93072.1
AL550371 mRNA No translation available.
CCDSiCCDS42771.1 [Q8IVI9-1]
CCDS42772.1 [Q8IVI9-3]
CCDS54415.1 [Q8IVI9-4]
CCDS54416.1 [Q8IVI9-2]
RefSeqiNP_001034813.2, NM_001039724.3 [Q8IVI9-1]
NP_001165102.1, NM_001171631.1 [Q8IVI9-4]
NP_001165103.1, NM_001171632.1 [Q8IVI9-2]
NP_443178.2, NM_052946.3 [Q8IVI9-3]
UniGeneiHs.189780

Genome annotation databases

EnsembliENST00000317647; ENSP00000318921; ENSG00000163072 [Q8IVI9-1]
ENST00000397206; ENSP00000380390; ENSG00000163072 [Q8IVI9-3]
ENST00000397209; ENSP00000380392; ENSG00000163072 [Q8IVI9-2]
ENST00000444448; ENSP00000394051; ENSG00000163072 [Q8IVI9-4]
ENST00000445023; ENSP00000404413; ENSG00000163072 [Q8IVI9-3]
ENST00000458381; ENSP00000402140; ENSG00000163072 [Q8IVI9-4]
GeneIDi115677
KEGGihsa:115677
UCSCiuc002uef.4 human [Q8IVI9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiNOSTN_HUMAN
AccessioniPrimary (citable) accession number: Q8IVI9
Secondary accession number(s): A8K2I9
, B3KSF5, E7EPT9, Q27HG3, Q53S62, Q96CJ9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: January 11, 2011
Last modified: May 23, 2018
This is version 146 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health