Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8IVI9

- NOSTN_HUMAN

UniProt

Q8IVI9 - NOSTN_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Nostrin

Gene

NOSTRIN

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Multivalent adapter protein which may decrease NOS3 activity by inducing its translocation away from the plasma membrane.3 Publications

GO - Molecular functioni

  1. DNA binding Source: Ensembl

GO - Biological processi

  1. endocytosis Source: UniProtKB-KW
  2. negative regulation of transcription, DNA-templated Source: Ensembl
  3. nitric oxide metabolic process Source: Reactome
  4. regulation of nitric-oxide synthase activity Source: Reactome
  5. signal transduction Source: InterPro
  6. small molecule metabolic process Source: Reactome
Complete GO annotation...

Keywords - Biological processi

Endocytosis

Enzyme and pathway databases

ReactomeiREACT_12541. NOSTRIN mediated eNOS trafficking.

Names & Taxonomyi

Protein namesi
Recommended name:
Nostrin
Alternative name(s):
BM247 homolog
Nitric oxide synthase traffic inducer
Nitric oxide synthase trafficker
eNOS-trafficking inducer
Gene namesi
Name:NOSTRIN
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2, UP000005640: Unplaced

Organism-specific databases

HGNCiHGNC:20203. NOSTRIN.

Subcellular locationi

Isoform 3 : Nucleus 1 Publication

GO - Cellular componenti

  1. cytoskeleton Source: UniProtKB-KW
  2. endocytic vesicle membrane Source: Reactome
  3. nucleus Source: Ensembl
  4. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Membrane, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134992787.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 506506NostrinPRO_0000289089Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei479 – 4791PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8IVI9.
PaxDbiQ8IVI9.
PRIDEiQ8IVI9.

PTM databases

PhosphoSiteiQ8IVI9.

Expressioni

Tissue specificityi

Expressed at highest levels in heart, kidney, placenta and lung, and at lowest levels in brain, thymus and spleen. Present in vascular endothelial cells and placenta. Over-expressed in placenta from women with pre-eclampsia (at protein level).2 Publications

Gene expression databases

BgeeiQ8IVI9.
CleanExiHS_NOSTRIN.
ExpressionAtlasiQ8IVI9. baseline and differential.
GenevestigatoriQ8IVI9.

Organism-specific databases

HPAiHPA044384.

Interactioni

Subunit structurei

Homotrimer. Interacts with DAB2 (By similarity). Interacts with NOS3, DNM2, WASL and CAV1.By similarity3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
DNM1Q051933EBI-1391643,EBI-713135
FGFR1P113625EBI-1391643,EBI-1028277
NOS3P294749EBI-1391643,EBI-1391623
WaslO088163EBI-1391643,EBI-6142604From a different organism.

Protein-protein interaction databases

BioGridi125446. 4 interactions.
IntActiQ8IVI9. 14 interactions.
STRINGi9606.ENSP00000318921.

Structurei

Secondary structure

1
506
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi441 – 4477Combined sources
Beta strandi464 – 4696Combined sources
Beta strandi472 – 4743Combined sources
Beta strandi476 – 4827Combined sources
Beta strandi484 – 4874Combined sources
Beta strandi492 – 4976Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2YUNNMR-A441-506[»]
ProteinModelPortaliQ8IVI9.
SMRiQ8IVI9. Positions 434-506.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8IVI9.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 6666FCHPROSITE-ProRule annotationAdd
BLAST
Domaini438 – 49760SH3PROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili160 – 22263Sequence AnalysisAdd
BLAST

Domaini

The SH3 domain mediates interaction with NOS3, DNM2 and WASL.
The FCH domain is necessary for membrane targeting.

Sequence similaritiesi

Contains 1 FCH domain.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

eggNOGiNOG266189.
GeneTreeiENSGT00510000048120.
HOGENOMiHOG000113830.
HOVERGENiHBG101730.
InParanoidiQ8IVI9.
OMAiHIREMLL.
PhylomeDBiQ8IVI9.

Family and domain databases

InterProiIPR001060. FCH_dom.
IPR011072. HR1_rho-bd.
IPR028535. Nostrin.
IPR001452. SH3_domain.
[Graphical view]
PANTHERiPTHR14167:SF22. PTHR14167:SF22. 1 hit.
PfamiPF00611. FCH. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view]
PRINTSiPR00452. SH3DOMAIN.
SMARTiSM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF46585. SSF46585. 1 hit.
SSF50044. SSF50044. 1 hit.
PROSITEiPS50133. FCH. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8IVI9-1) [UniParc]FASTAAdd to Basket

Also known as: NOSTRINalpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRDPLTDCPY NKVYKNLKEF SQNGENFCKQ VTSVLQQRAN LEISYAKGLQ
60 70 80 90 100
KLASKLSKAL QNTRKSCVSS AWAWASEGMK STADLHQKLG KAIELEAIKP
110 120 130 140 150
TYQVLNVQEK KRKSLDNEVE KTANLVISNW NQQIKAKKKL MVSTKKHEAL
160 170 180 190 200
FQLVESSKQS MTEKEKRKLL NKLTKSTEKL EKEDENYYQK NMAGYSTRLK
210 220 230 240 250
WENTLENCYQ SILELEKERI QLLCNNLNQY SQHISLFGQT LTTCHTQIHC
260 270 280 290 300
AISKIDIEKD IQAVMEETAI LSTENKSEFL LTDYFEEDPN SAMDKERRKS
310 320 330 340 350
LLKPKLLRLQ RDIEKASKDK EGLERMLKTY SSTSSFSDAK SQKDTAALMD
360 370 380 390 400
ENNLKLDLLE ANSYKLSSML AELEQRPQPS HPCSNSIFRW REKEHTHSYV
410 420 430 440 450
KISRPFLMKR LENIVSKASS GGQSNPGSST PAPGAAQLSS RLCKALYSFQ
460 470 480 490 500
ARQDDELNLE KGDIVIIHEK KEGGWWFGSL NGKKGHFPAA YVEELPSNAG

NTATKA
Length:506
Mass (Da):57,660
Last modified:January 11, 2011 - v2
Checksum:iDC9A6DF5B9C2AED0
GO
Isoform 2 (identifier: Q8IVI9-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     38-65: Missing.

Show »
Length:478
Mass (Da):54,547
Checksum:iE8E6E3B37569F432
GO
Isoform 3 (identifier: Q8IVI9-3) [UniParc]FASTAAdd to Basket

Also known as: NOSTRINbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-78: Missing.

Note: May negatively regulate transcription of the NOSTRIN gene.1 Publication

Show »
Length:428
Mass (Da):48,876
Checksum:i8819706D71DAC60C
GO
Isoform 4 (identifier: Q8IVI9-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     209-209: Y → YQVTHSICLYAFWVKRAWGKCVSDLRYQDTFLPGNLPPLWFGYDIVKRLIMRLCSVCL

Note: No experimental confirmation available.Curated

Show »
Length:563
Mass (Da):64,364
Checksum:i6FE667B285DD4D54
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti225 – 2251N → D in BAG52717. (PubMed:14702039)Curated
Isoform 4 (identifier: Q8IVI9-4)
Sequence conflicti238 – 2381T → I in BAG52717. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti473 – 4731G → E.4 Publications
Corresponds to variant rs479661 [ dbSNP | Ensembl ].
VAR_032569

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7878Missing in isoform 3. 1 PublicationVSP_025884Add
BLAST
Alternative sequencei38 – 6528Missing in isoform 2. 1 PublicationVSP_025885Add
BLAST
Alternative sequencei209 – 2091Y → YQVTHSICLYAFWVKRAWGK CVSDLRYQDTFLPGNLPPLW FGYDIVKRLIMRLCSVCL in isoform 4. 1 PublicationVSP_044995

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ532842 mRNA. Translation: CAD58724.1.
DQ402497 mRNA. Translation: ABD62889.1.
AK002203 mRNA. Translation: BAE46614.1.
AK093444 mRNA. Translation: BAG52717.1.
AK290254 mRNA. Translation: BAF82943.1.
AC069137 Genomic DNA. Translation: AAY24097.1.
AC009475 Genomic DNA. No translation available.
BC014189 mRNA. Translation: AAH14189.1.
BC093072 mRNA. Translation: AAH93072.1.
AL550371 mRNA. No translation available.
CCDSiCCDS42771.1. [Q8IVI9-1]
CCDS42772.1. [Q8IVI9-3]
CCDS54415.1. [Q8IVI9-4]
CCDS54416.1. [Q8IVI9-2]
RefSeqiNP_001034813.2. NM_001039724.3. [Q8IVI9-1]
NP_001165102.1. NM_001171631.1. [Q8IVI9-4]
NP_001165103.1. NM_001171632.1. [Q8IVI9-2]
NP_443178.2. NM_052946.3. [Q8IVI9-3]
UniGeneiHs.189780.

Genome annotation databases

EnsembliENST00000317647; ENSP00000318921; ENSG00000163072. [Q8IVI9-1]
ENST00000397206; ENSP00000380390; ENSG00000163072. [Q8IVI9-3]
ENST00000397209; ENSP00000380392; ENSG00000163072. [Q8IVI9-2]
ENST00000444448; ENSP00000394051; ENSG00000163072. [Q8IVI9-4]
ENST00000445023; ENSP00000404413; ENSG00000163072. [Q8IVI9-3]
ENST00000458381; ENSP00000402140; ENSG00000163072. [Q8IVI9-4]
GeneIDi115677.
KEGGihsa:115677.
UCSCiuc002uef.3. human.
uc002ueg.3. human. [Q8IVI9-1]
uc010fpu.3. human. [Q8IVI9-2]

Polymorphism databases

DMDMi317373401.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ532842 mRNA. Translation: CAD58724.1 .
DQ402497 mRNA. Translation: ABD62889.1 .
AK002203 mRNA. Translation: BAE46614.1 .
AK093444 mRNA. Translation: BAG52717.1 .
AK290254 mRNA. Translation: BAF82943.1 .
AC069137 Genomic DNA. Translation: AAY24097.1 .
AC009475 Genomic DNA. No translation available.
BC014189 mRNA. Translation: AAH14189.1 .
BC093072 mRNA. Translation: AAH93072.1 .
AL550371 mRNA. No translation available.
CCDSi CCDS42771.1. [Q8IVI9-1 ]
CCDS42772.1. [Q8IVI9-3 ]
CCDS54415.1. [Q8IVI9-4 ]
CCDS54416.1. [Q8IVI9-2 ]
RefSeqi NP_001034813.2. NM_001039724.3. [Q8IVI9-1 ]
NP_001165102.1. NM_001171631.1. [Q8IVI9-4 ]
NP_001165103.1. NM_001171632.1. [Q8IVI9-2 ]
NP_443178.2. NM_052946.3. [Q8IVI9-3 ]
UniGenei Hs.189780.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2YUN NMR - A 441-506 [» ]
ProteinModelPortali Q8IVI9.
SMRi Q8IVI9. Positions 434-506.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 125446. 4 interactions.
IntActi Q8IVI9. 14 interactions.
STRINGi 9606.ENSP00000318921.

PTM databases

PhosphoSitei Q8IVI9.

Polymorphism databases

DMDMi 317373401.

Proteomic databases

MaxQBi Q8IVI9.
PaxDbi Q8IVI9.
PRIDEi Q8IVI9.

Protocols and materials databases

DNASUi 115677.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000317647 ; ENSP00000318921 ; ENSG00000163072 . [Q8IVI9-1 ]
ENST00000397206 ; ENSP00000380390 ; ENSG00000163072 . [Q8IVI9-3 ]
ENST00000397209 ; ENSP00000380392 ; ENSG00000163072 . [Q8IVI9-2 ]
ENST00000444448 ; ENSP00000394051 ; ENSG00000163072 . [Q8IVI9-4 ]
ENST00000445023 ; ENSP00000404413 ; ENSG00000163072 . [Q8IVI9-3 ]
ENST00000458381 ; ENSP00000402140 ; ENSG00000163072 . [Q8IVI9-4 ]
GeneIDi 115677.
KEGGi hsa:115677.
UCSCi uc002uef.3. human.
uc002ueg.3. human. [Q8IVI9-1 ]
uc010fpu.3. human. [Q8IVI9-2 ]

Organism-specific databases

CTDi 115677.
GeneCardsi GC02P169643.
HGNCi HGNC:20203. NOSTRIN.
HPAi HPA044384.
MIMi 607496. gene.
neXtProti NX_Q8IVI9.
PharmGKBi PA134992787.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG266189.
GeneTreei ENSGT00510000048120.
HOGENOMi HOG000113830.
HOVERGENi HBG101730.
InParanoidi Q8IVI9.
OMAi HIREMLL.
PhylomeDBi Q8IVI9.

Enzyme and pathway databases

Reactomei REACT_12541. NOSTRIN mediated eNOS trafficking.

Miscellaneous databases

ChiTaRSi NOSTRIN. human.
EvolutionaryTracei Q8IVI9.
GenomeRNAii 115677.
NextBioi 79640.
PROi Q8IVI9.
SOURCEi Search...

Gene expression databases

Bgeei Q8IVI9.
CleanExi HS_NOSTRIN.
ExpressionAtlasi Q8IVI9. baseline and differential.
Genevestigatori Q8IVI9.

Family and domain databases

InterProi IPR001060. FCH_dom.
IPR011072. HR1_rho-bd.
IPR028535. Nostrin.
IPR001452. SH3_domain.
[Graphical view ]
PANTHERi PTHR14167:SF22. PTHR14167:SF22. 1 hit.
Pfami PF00611. FCH. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view ]
PRINTSi PR00452. SH3DOMAIN.
SMARTi SM00326. SH3. 1 hit.
[Graphical view ]
SUPFAMi SSF46585. SSF46585. 1 hit.
SSF50044. SSF50044. 1 hit.
PROSITEi PS50133. FCH. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "NOSTRIN: a protein modulating nitric oxide release and subcellular distribution of endothelial nitric oxide synthase."
    Zimmermann K., Opitz N., Dedio J., Renne C., Mueller-Esterl W., Oess S.
    Proc. Natl. Acad. Sci. U.S.A. 99:17167-17172(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, INTERACTION WITH NOS3, SUBCELLULAR LOCATION, FUNCTION, VARIANT GLU-473.
    Tissue: Placenta.
  2. "Molecular characterization of an alternatively spliced variant of human NOSTRIN."
    Beese M., Kirsch T.
    Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT GLU-473.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANT GLU-473.
    Tissue: Colon, Placenta and Testis.
  4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT GLU-473.
    Tissue: Placenta and Thyroid.
  6. "Full-length cDNA libraries and normalization."
    Li W.B., Gruber C., Jessee J., Polayes D.
    Submitted (APR-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-304.
    Tissue: Placenta.
  7. "Altered gene expression in cerebral capillaries of stroke-prone spontaneously hypertensive rats."
    Kirsch T., Wellner M., Luft F.C., Haller H., Lippoldt A.
    Brain Res. 910:106-115(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION.
  8. "Expression of endothelial nitric oxide synthase traffic inducer in the placentas of women with pre-eclampsia."
    Xiang W., Chen H., Xu X., Zhang M., Jiang R.
    Int. J. Gynecol. Obstet. 89:103-107(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  9. "NOSTRIN functions as a homotrimeric adaptor protein facilitating internalization of eNOS."
    Icking A., Matt S., Opitz N., Wiesenthal A., Mueller-Esterl W., Schilling K.
    J. Cell Sci. 118:5059-5069(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBUNIT, INTERACTION WITH DNM2 AND WASL, SUBCELLULAR LOCATION, FUNCTION.
  10. "FCH/Cdc15 domain determines distinct subcellular localization of NOSTRIN."
    Icking A., Schilling K., Wiesenthal A., Opitz N., Mueller-Esterl W.
    FEBS Lett. 580:223-228(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  11. "Translocation of endothelial nitric-oxide synthase involves a ternary complex with caveolin-1 and NOSTRIN."
    Schilling K., Opitz N., Wiesenthal A., Oess S., Tikkanen R., Mueller-Esterl W., Icking A.
    Mol. Biol. Cell 17:3870-3880(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH CAV1, FUNCTION.
  12. "NOSTRINbeta--a shortened NOSTRIN variant with a role in transcriptional regulation."
    Wiesenthal A., Hoffmeister M., Siddique M., Kovacevic I., Oess S., Muller-Esterl W., Siehoff-Icking A.
    Traffic 10:26-34(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION (ISOFORM 3).
  13. "Solution structure of the SH3 domain of human nostrin."
    RIKEN structural genomics initiative (RSGI)
    Submitted (OCT-2007) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 439-506.

Entry informationi

Entry nameiNOSTN_HUMAN
AccessioniPrimary (citable) accession number: Q8IVI9
Secondary accession number(s): A8K2I9
, B3KSF5, E7EPT9, Q27HG3, Q53S62, Q96CJ9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: January 11, 2011
Last modified: November 26, 2014
This is version 118 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3