Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nostrin

Gene

NOSTRIN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Multivalent adapter protein which may decrease NOS3 activity by inducing its translocation away from the plasma membrane.3 Publications

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Endocytosis

Enzyme and pathway databases

ReactomeiR-HSA-203641. NOSTRIN mediated eNOS trafficking.

Names & Taxonomyi

Protein namesi
Recommended name:
Nostrin
Alternative name(s):
BM247 homolog
Nitric oxide synthase traffic inducer
Nitric oxide synthase trafficker
eNOS-trafficking inducer
Gene namesi
Name:NOSTRIN
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:20203. NOSTRIN.

Subcellular locationi

Isoform 1 :
Isoform 3 :

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Membrane, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi115677.
OpenTargetsiENSG00000163072.
PharmGKBiPA134992787.

Polymorphism and mutation databases

BioMutaiNOSTRIN.
DMDMi317373401.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002890891 – 506NostrinAdd BLAST506

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei114PhosphoserineBy similarity1
Modified residuei479PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8IVI9.
PeptideAtlasiQ8IVI9.
PRIDEiQ8IVI9.

PTM databases

iPTMnetiQ8IVI9.
PhosphoSitePlusiQ8IVI9.

Expressioni

Tissue specificityi

Expressed at highest levels in heart, kidney, placenta and lung, and at lowest levels in brain, thymus and spleen. Present in vascular endothelial cells and placenta. Over-expressed in placenta from women with pre-eclampsia (at protein level).2 Publications

Gene expression databases

BgeeiENSG00000163072.
CleanExiHS_NOSTRIN.
ExpressionAtlasiQ8IVI9. baseline and differential.
GenevisibleiQ8IVI9. HS.

Organism-specific databases

HPAiHPA044384.

Interactioni

Subunit structurei

Homotrimer. Interacts with DAB2 (By similarity). Interacts with NOS3, DNM2, WASL and CAV1.By similarity3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
DNM1Q051933EBI-1391643,EBI-713135
FGFR1P113625EBI-1391643,EBI-1028277
NOS3P294749EBI-1391643,EBI-1391623
WaslO088163EBI-1391643,EBI-6142604From a different organism.

Protein-protein interaction databases

BioGridi125446. 4 interactors.
IntActiQ8IVI9. 15 interactors.

Structurei

Secondary structure

1506
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi441 – 447Combined sources7
Beta strandi464 – 469Combined sources6
Beta strandi472 – 474Combined sources3
Beta strandi476 – 482Combined sources7
Beta strandi484 – 487Combined sources4
Beta strandi492 – 497Combined sources6

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2YUNNMR-A441-506[»]
ProteinModelPortaliQ8IVI9.
SMRiQ8IVI9.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8IVI9.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 260F-BARPROSITE-ProRule annotationAdd BLAST260
Domaini438 – 497SH3PROSITE-ProRule annotationAdd BLAST60

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili160 – 222Sequence analysisAdd BLAST63

Domaini

The SH3 domain mediates interaction with NOS3, DNM2 and WASL.
The F-BAR domain is necessary for membrane targeting.

Sequence similaritiesi

Contains 1 F-BAR domain.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

GeneTreeiENSGT00510000048120.
HOGENOMiHOG000113830.
HOVERGENiHBG101730.
InParanoidiQ8IVI9.
KOiK20126.
OMAiSEWRVSE.
OrthoDBiEOG091G01QT.
PhylomeDBiQ8IVI9.

Family and domain databases

Gene3Di1.10.287.160. 1 hit.
InterProiIPR031160. F_BAR.
IPR001060. FCH_dom.
IPR011072. HR1_rho-bd.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00611. FCH. 1 hit.
PF14604. SH3_9. 1 hit.
[Graphical view]
PRINTSiPR00452. SH3DOMAIN.
SMARTiSM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF46585. SSF46585. 1 hit.
SSF50044. SSF50044. 1 hit.
PROSITEiPS51741. F_BAR. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8IVI9-1) [UniParc]FASTAAdd to basket
Also known as: NOSTRINalpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRDPLTDCPY NKVYKNLKEF SQNGENFCKQ VTSVLQQRAN LEISYAKGLQ
60 70 80 90 100
KLASKLSKAL QNTRKSCVSS AWAWASEGMK STADLHQKLG KAIELEAIKP
110 120 130 140 150
TYQVLNVQEK KRKSLDNEVE KTANLVISNW NQQIKAKKKL MVSTKKHEAL
160 170 180 190 200
FQLVESSKQS MTEKEKRKLL NKLTKSTEKL EKEDENYYQK NMAGYSTRLK
210 220 230 240 250
WENTLENCYQ SILELEKERI QLLCNNLNQY SQHISLFGQT LTTCHTQIHC
260 270 280 290 300
AISKIDIEKD IQAVMEETAI LSTENKSEFL LTDYFEEDPN SAMDKERRKS
310 320 330 340 350
LLKPKLLRLQ RDIEKASKDK EGLERMLKTY SSTSSFSDAK SQKDTAALMD
360 370 380 390 400
ENNLKLDLLE ANSYKLSSML AELEQRPQPS HPCSNSIFRW REKEHTHSYV
410 420 430 440 450
KISRPFLMKR LENIVSKASS GGQSNPGSST PAPGAAQLSS RLCKALYSFQ
460 470 480 490 500
ARQDDELNLE KGDIVIIHEK KEGGWWFGSL NGKKGHFPAA YVEELPSNAG

NTATKA
Length:506
Mass (Da):57,660
Last modified:January 11, 2011 - v2
Checksum:iDC9A6DF5B9C2AED0
GO
Isoform 2 (identifier: Q8IVI9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     38-65: Missing.

Show »
Length:478
Mass (Da):54,547
Checksum:iE8E6E3B37569F432
GO
Isoform 3 (identifier: Q8IVI9-3) [UniParc]FASTAAdd to basket
Also known as: NOSTRINbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-78: Missing.

Note: May negatively regulate transcription of the NOSTRIN gene.1 Publication
Show »
Length:428
Mass (Da):48,876
Checksum:i8819706D71DAC60C
GO
Isoform 4 (identifier: Q8IVI9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     209-209: Y → YQVTHSICLYAFWVKRAWGKCVSDLRYQDTFLPGNLPPLWFGYDIVKRLIMRLCSVCL

Note: No experimental confirmation available.Curated
Show »
Length:563
Mass (Da):64,364
Checksum:i6FE667B285DD4D54
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti225N → D in BAG52717 (PubMed:14702039).Curated1
Isoform 4 (identifier: Q8IVI9-4)
Sequence conflicti238T → I in BAG52717 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_032569473G → E.4 PublicationsCorresponds to variant rs479661dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0258841 – 78Missing in isoform 3. 1 PublicationAdd BLAST78
Alternative sequenceiVSP_02588538 – 65Missing in isoform 2. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_044995209Y → YQVTHSICLYAFWVKRAWGK CVSDLRYQDTFLPGNLPPLW FGYDIVKRLIMRLCSVCL in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ532842 mRNA. Translation: CAD58724.1.
DQ402497 mRNA. Translation: ABD62889.1.
AK002203 mRNA. Translation: BAE46614.1.
AK093444 mRNA. Translation: BAG52717.1.
AK290254 mRNA. Translation: BAF82943.1.
AC069137 Genomic DNA. Translation: AAY24097.1.
AC009475 Genomic DNA. No translation available.
BC014189 mRNA. Translation: AAH14189.1.
BC093072 mRNA. Translation: AAH93072.1.
AL550371 mRNA. No translation available.
CCDSiCCDS42771.1. [Q8IVI9-1]
CCDS42772.1. [Q8IVI9-3]
CCDS54415.1. [Q8IVI9-4]
CCDS54416.1. [Q8IVI9-2]
RefSeqiNP_001034813.2. NM_001039724.3. [Q8IVI9-1]
NP_001165102.1. NM_001171631.1. [Q8IVI9-4]
NP_001165103.1. NM_001171632.1. [Q8IVI9-2]
NP_443178.2. NM_052946.3. [Q8IVI9-3]
UniGeneiHs.189780.

Genome annotation databases

EnsembliENST00000317647; ENSP00000318921; ENSG00000163072. [Q8IVI9-1]
ENST00000397206; ENSP00000380390; ENSG00000163072. [Q8IVI9-3]
ENST00000397209; ENSP00000380392; ENSG00000163072. [Q8IVI9-2]
ENST00000444448; ENSP00000394051; ENSG00000163072. [Q8IVI9-4]
ENST00000445023; ENSP00000404413; ENSG00000163072. [Q8IVI9-3]
ENST00000458381; ENSP00000402140; ENSG00000163072. [Q8IVI9-4]
GeneIDi115677.
KEGGihsa:115677.
UCSCiuc002uef.4. human. [Q8IVI9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ532842 mRNA. Translation: CAD58724.1.
DQ402497 mRNA. Translation: ABD62889.1.
AK002203 mRNA. Translation: BAE46614.1.
AK093444 mRNA. Translation: BAG52717.1.
AK290254 mRNA. Translation: BAF82943.1.
AC069137 Genomic DNA. Translation: AAY24097.1.
AC009475 Genomic DNA. No translation available.
BC014189 mRNA. Translation: AAH14189.1.
BC093072 mRNA. Translation: AAH93072.1.
AL550371 mRNA. No translation available.
CCDSiCCDS42771.1. [Q8IVI9-1]
CCDS42772.1. [Q8IVI9-3]
CCDS54415.1. [Q8IVI9-4]
CCDS54416.1. [Q8IVI9-2]
RefSeqiNP_001034813.2. NM_001039724.3. [Q8IVI9-1]
NP_001165102.1. NM_001171631.1. [Q8IVI9-4]
NP_001165103.1. NM_001171632.1. [Q8IVI9-2]
NP_443178.2. NM_052946.3. [Q8IVI9-3]
UniGeneiHs.189780.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2YUNNMR-A441-506[»]
ProteinModelPortaliQ8IVI9.
SMRiQ8IVI9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125446. 4 interactors.
IntActiQ8IVI9. 15 interactors.

PTM databases

iPTMnetiQ8IVI9.
PhosphoSitePlusiQ8IVI9.

Polymorphism and mutation databases

BioMutaiNOSTRIN.
DMDMi317373401.

Proteomic databases

MaxQBiQ8IVI9.
PeptideAtlasiQ8IVI9.
PRIDEiQ8IVI9.

Protocols and materials databases

DNASUi115677.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000317647; ENSP00000318921; ENSG00000163072. [Q8IVI9-1]
ENST00000397206; ENSP00000380390; ENSG00000163072. [Q8IVI9-3]
ENST00000397209; ENSP00000380392; ENSG00000163072. [Q8IVI9-2]
ENST00000444448; ENSP00000394051; ENSG00000163072. [Q8IVI9-4]
ENST00000445023; ENSP00000404413; ENSG00000163072. [Q8IVI9-3]
ENST00000458381; ENSP00000402140; ENSG00000163072. [Q8IVI9-4]
GeneIDi115677.
KEGGihsa:115677.
UCSCiuc002uef.4. human. [Q8IVI9-1]

Organism-specific databases

CTDi115677.
DisGeNETi115677.
GeneCardsiNOSTRIN.
HGNCiHGNC:20203. NOSTRIN.
HPAiHPA044384.
MIMi607496. gene.
neXtProtiNX_Q8IVI9.
OpenTargetsiENSG00000163072.
PharmGKBiPA134992787.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00510000048120.
HOGENOMiHOG000113830.
HOVERGENiHBG101730.
InParanoidiQ8IVI9.
KOiK20126.
OMAiSEWRVSE.
OrthoDBiEOG091G01QT.
PhylomeDBiQ8IVI9.

Enzyme and pathway databases

ReactomeiR-HSA-203641. NOSTRIN mediated eNOS trafficking.

Miscellaneous databases

ChiTaRSiNOSTRIN. human.
EvolutionaryTraceiQ8IVI9.
GenomeRNAii115677.
PROiQ8IVI9.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000163072.
CleanExiHS_NOSTRIN.
ExpressionAtlasiQ8IVI9. baseline and differential.
GenevisibleiQ8IVI9. HS.

Family and domain databases

Gene3Di1.10.287.160. 1 hit.
InterProiIPR031160. F_BAR.
IPR001060. FCH_dom.
IPR011072. HR1_rho-bd.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00611. FCH. 1 hit.
PF14604. SH3_9. 1 hit.
[Graphical view]
PRINTSiPR00452. SH3DOMAIN.
SMARTiSM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF46585. SSF46585. 1 hit.
SSF50044. SSF50044. 1 hit.
PROSITEiPS51741. F_BAR. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNOSTN_HUMAN
AccessioniPrimary (citable) accession number: Q8IVI9
Secondary accession number(s): A8K2I9
, B3KSF5, E7EPT9, Q27HG3, Q53S62, Q96CJ9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: January 11, 2011
Last modified: November 30, 2016
This is version 136 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.