Q8IVI9 (NOSTN_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 103.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Nostrin Alternative name(s): BM247 homolog Nitric oxide synthase traffic inducer Nitric oxide synthase trafficker eNOS-trafficking inducer | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 506 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Multivalent adapter protein which may decrease NOS3 activity by inducing its translocation away from the plasma membrane. Ref.1 Ref.9 Ref.11 |
| Subunit structure | Homotrimer. Interacts with DAB2 By similarity. Interacts with NOS3, DNM2, WASL and CAV1. Ref.1 Ref.9 Ref.11 |
| Subcellular location | Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasmic vesicle. Cytoplasm › cytoskeleton. Note: Enriched in selected actin structures. Ref.1 Ref.9 Ref.10 |
| Tissue specificity | Expressed at highest levels in heart, kidney, placenta and lung, and at lowest levels in brain, thymus and spleen. Present in vascular endothelial cells and placenta. Over-expressed in placenta from women with pre-eclampsia (at protein level). Ref.1 Ref.8 |
| Domain | The SH3 domain mediates interaction with NOS3, DNM2 and WASL. The FCH domain is necessary for membrane targeting. |
| Sequence similarities | Contains 1 FCH domain. Contains 1 SH3 domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Endocytosis |
| Cellular component | Cell membrane Cytoplasm Cytoplasmic vesicle Cytoskeleton Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil SH3 domain |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | endocytosis Inferred from electronic annotation. Source: UniProtKB-KW nitric oxide metabolic processTraceable author statement. Source: Reactome regulation of nitric-oxide synthase activityTraceable author statement. Source: Reactome small molecule metabolic processTraceable author statement. Source: Reactome |
| Cellular_component | cytoskeleton Inferred from electronic annotation. Source: UniProtKB-SubCell endocytic vesicle membraneTraceable author statement. Source: Reactome plasma membraneTraceable author statement. Source: Reactome |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| NOS3 | P29474 | 7 | EBI-1391643,EBI-1391623 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8IVI9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8IVI9-2) The sequence of this isoform differs from the canonical sequence as follows: 38-65: Missing. | ||||||
| Isoform 3 (identifier: Q8IVI9-3) The sequence of this isoform differs from the canonical sequence as follows: 1-78: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q8IVI9-4) The sequence of this isoform differs from the canonical sequence as follows: 209-209: Y → YQVTHSICLYAFWVKRAWGKCVSDLRYQDTFLPGNLPPLWFGYDIVKRLIMRLCSVCL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||
Molecule processing | |||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 506 | 506 | Nostrin | PRO_0000289089 | |||||||||||||||||
Regions | |||||||||||||||||||||
| Domain | 1 – 66 | 66 | FCH | ||||||||||||||||||
| Domain | 438 – 497 | 60 | SH3 | ||||||||||||||||||
| Coiled coil | 160 – 222 | 63 | Potential | ||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||
| Modified residue | 479 | 1 | Phosphoserine By similarity | ||||||||||||||||||
Natural variations | |||||||||||||||||||||
| Alternative sequence | 1 – 78 | 78 | Missing in isoform 3. | VSP_025884 | |||||||||||||||||
| Alternative sequence | 38 – 65 | 28 | Missing in isoform 2. | VSP_025885 | |||||||||||||||||
| Alternative sequence | 209 | 1 | Y → YQVTHSICLYAFWVKRAWGK CVSDLRYQDTFLPGNLPPLW FGYDIVKRLIMRLCSVCL in isoform 4. | VSP_044995 | |||||||||||||||||
| Natural variant | 473 | 1 | G → E. Ref.1 Ref.2 Ref.3 Ref.5 Corresponds to variant rs479661 [ dbSNP | Ensembl ]. | VAR_032569 | |||||||||||||||||
Experimental info | |||||||||||||||||||||
| Sequence conflict | 225 | 1 | N → D in BAG52717. Ref.3 | ||||||||||||||||||
| Isoform 4: | |||||||||||||||||||||
| Sequence conflict | 238 | 1 | T → I in BAG52717. Ref.3 | ||||||||||||||||||
Secondary structure | |||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||
| Beta strand | 441 – 447 | 7 | |||||||||||||||||||
| Beta strand | 464 – 469 | 6 | |||||||||||||||||||
| Beta strand | 472 – 474 | 3 | |||||||||||||||||||
| Beta strand | 476 – 482 | 7 | |||||||||||||||||||
| Beta strand | 484 – 487 | 4 | |||||||||||||||||||
| Beta strand | 492 – 497 | 6 | |||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "NOSTRIN: a protein modulating nitric oxide release and subcellular distribution of endothelial nitric oxide synthase." Zimmermann K., Opitz N., Dedio J., Renne C., Mueller-Esterl W., Oess S. Proc. Natl. Acad. Sci. U.S.A. 99:17167-17172(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, INTERACTION WITH NOS3, SUBCELLULAR LOCATION, FUNCTION, VARIANT GLU-473. Tissue: Placenta. |
| [2] | "Molecular characterization of an alternatively spliced variant of human NOSTRIN." Beese M., Kirsch T. Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT GLU-473. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANT GLU-473. Tissue: Colon, Placenta and Testis. |
| [4] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT GLU-473. Tissue: Placenta and Thyroid. |
| [6] | "Full-length cDNA libraries and normalization." Li W.B., Gruber C., Jessee J., Polayes D. Submitted (APR-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-304. Tissue: Placenta. |
| [7] | "Altered gene expression in cerebral capillaries of stroke-prone spontaneously hypertensive rats." Kirsch T., Wellner M., Luft F.C., Haller H., Lippoldt A. Brain Res. 910:106-115(2001) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION. |
| [8] | "Expression of endothelial nitric oxide synthase traffic inducer in the placentas of women with pre-eclampsia." Xiang W., Chen H., Xu X., Zhang M., Jiang R. Int. J. Gynecol. Obstet. 89:103-107(2005) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [9] | "NOSTRIN functions as a homotrimeric adaptor protein facilitating internalization of eNOS." Icking A., Matt S., Opitz N., Wiesenthal A., Mueller-Esterl W., Schilling K. J. Cell Sci. 118:5059-5069(2005) [PubMed] [Europe PMC] [Abstract] Cited for: SUBUNIT, INTERACTION WITH DNM2 AND WASL, SUBCELLULAR LOCATION, FUNCTION. |
| [10] | "FCH/Cdc15 domain determines distinct subcellular localization of NOSTRIN." Icking A., Schilling K., Wiesenthal A., Opitz N., Mueller-Esterl W. FEBS Lett. 580:223-228(2006) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [11] | "Translocation of endothelial nitric-oxide synthase involves a ternary complex with caveolin-1 and NOSTRIN." Schilling K., Opitz N., Wiesenthal A., Oess S., Tikkanen R., Mueller-Esterl W., Icking A. Mol. Biol. Cell 17:3870-3880(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CAV1, FUNCTION. |
| [12] | "Solution structure of the SH3 domain of human nostrin." RIKEN structural genomics initiative (RSGI) Submitted (OCT-2007) to the PDB data bank Cited for: STRUCTURE BY NMR OF 439-506. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AJ532842 mRNA. Translation: CAD58724.1. DQ402497 mRNA. Translation: ABD62889.1. AK002203 mRNA. Translation: BAE46614.1. AK093444 mRNA. Translation: BAG52717.1. AK290254 mRNA. Translation: BAF82943.1. AC069137 Genomic DNA. Translation: AAY24097.1. AC009475 Genomic DNA. No translation available. BC014189 mRNA. Translation: AAH14189.1. BC093072 mRNA. Translation: AAH93072.1. AL550371 mRNA. No translation available. | ||||||||||||
| IPI | IPI00549783. IPI00738288. IPI00848266. IPI00927526. | ||||||||||||
| RefSeq | NP_001034813.2. NM_001039724.3. NP_001165102.1. NM_001171631.1. NP_001165103.1. NM_001171632.1. NP_443178.2. NM_052946.3. | ||||||||||||
| UniGene | Hs.189780. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q8IVI9. | ||||||||||||
| SMR | Q8IVI9. Positions 434-506. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q8IVI9. 5 interactions. | ||||||||||||
| STRING | 9606.ENSP00000318921. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q8IVI9. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 74728063. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q8IVI9. | ||||||||||||
| PRIDE | Q8IVI9. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 115677. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000317647; ENSP00000318921; ENSG00000163072. ENST00000397206; ENSP00000380390; ENSG00000163072. ENST00000397209; ENSP00000380392; ENSG00000163072. ENST00000421711; ENSP00000401316; ENSG00000163072. ENST00000444448; ENSP00000394051; ENSG00000163072. ENST00000445023; ENSP00000404413; ENSG00000163072. ENST00000458381; ENSP00000402140; ENSG00000163072. ENST00000571377; ENSP00000460608; ENSG00000262773. ENST00000574102; ENSP00000460765; ENSG00000262773. ENST00000574750; ENSP00000458654; ENSG00000262773. ENST00000574986; ENSP00000460968; ENSG00000262773. ENST00000576231; ENSP00000461773; ENSG00000262773. | ||||||||||||
| GeneID | 115677. | ||||||||||||
| KEGG | hsa:115677. | ||||||||||||
| UCSC | uc002uef.3. human. uc002ueg.3. human. uc010fpu.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 115677. | ||||||||||||
| GeneCards | GC02P169643. | ||||||||||||
| HGNC | HGNC:20203. NOSTRIN. | ||||||||||||
| HPA | HPA044384. | ||||||||||||
| MIM | 607496. gene. | ||||||||||||
| neXtProt | NX_Q8IVI9. | ||||||||||||
| PharmGKB | PA134992787. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG266189. | ||||||||||||
| HOGENOM | HOG000113830. | ||||||||||||
| HOVERGEN | HBG101730. | ||||||||||||
| InParanoid | Q8IVI9. | ||||||||||||
| OMA | KKHEALF. | ||||||||||||
| OrthoDB | EOG469QV0. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_111217. Metabolism. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q8IVI9. | ||||||||||||
| Bgee | Q8IVI9. | ||||||||||||
| CleanEx | HS_NOSTRIN. | ||||||||||||
| Genevestigator | Q8IVI9. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR001060. FCH_dom. IPR001452. SH3_domain. [Graphical view] | ||||||||||||
| Pfam | PF00611. FCH. 1 hit. PF00018. SH3_1. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00452. SH3DOMAIN. | ||||||||||||
| SMART | SM00326. SH3. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF50044. SH3. 1 hit. | ||||||||||||
| PROSITE | PS50133. FCH. 1 hit. PS50002. SH3. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | Q8IVI9. | ||||||||||||
| GenomeRNAi | 115677. | ||||||||||||
| NextBio | 79640. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | NOSTN_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8IVI9 Secondary accession number(s): A8K2I9 Q96CJ9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
