Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8IVI9 (NOSTN_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 114. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Nostrin
Alternative name(s):
BM247 homolog
Nitric oxide synthase traffic inducer
Nitric oxide synthase trafficker
eNOS-trafficking inducer
Gene names
Name:NOSTRIN
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length506 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Multivalent adapter protein which may decrease NOS3 activity by inducing its translocation away from the plasma membrane. Ref.1 Ref.9 Ref.11

Subunit structure

Homotrimer. Interacts with DAB2 By similarity. Interacts with NOS3, DNM2, WASL and CAV1. Ref.1 Ref.9 Ref.11

Subcellular location

Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasmic vesicle. Cytoplasmcytoskeleton. Note: Enriched in selected actin structures. Ref.1 Ref.9 Ref.10

Tissue specificity

Expressed at highest levels in heart, kidney, placenta and lung, and at lowest levels in brain, thymus and spleen. Present in vascular endothelial cells and placenta. Over-expressed in placenta from women with pre-eclampsia (at protein level). Ref.1 Ref.8

Domain

The SH3 domain mediates interaction with NOS3, DNM2 and WASL.

The FCH domain is necessary for membrane targeting.

Sequence similarities

Contains 1 FCH domain.

Contains 1 SH3 domain.

Binary interactions

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8IVI9-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8IVI9-2)

The sequence of this isoform differs from the canonical sequence as follows:
     38-65: Missing.
Isoform 3 (identifier: Q8IVI9-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-78: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q8IVI9-4)

The sequence of this isoform differs from the canonical sequence as follows:
     209-209: Y → YQVTHSICLYAFWVKRAWGKCVSDLRYQDTFLPGNLPPLWFGYDIVKRLIMRLCSVCL
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 506506Nostrin
PRO_0000289089

Regions

Domain1 – 6666FCH
Domain438 – 49760SH3
Coiled coil160 – 22263 Potential

Amino acid modifications

Modified residue4791Phosphoserine By similarity

Natural variations

Alternative sequence1 – 7878Missing in isoform 3.
VSP_025884
Alternative sequence38 – 6528Missing in isoform 2.
VSP_025885
Alternative sequence2091Y → YQVTHSICLYAFWVKRAWGK CVSDLRYQDTFLPGNLPPLW FGYDIVKRLIMRLCSVCL in isoform 4.
VSP_044995
Natural variant4731G → E. Ref.1 Ref.2 Ref.3 Ref.5
Corresponds to variant rs479661 [ dbSNP | Ensembl ].
VAR_032569

Experimental info

Sequence conflict2251N → D in BAG52717. Ref.3
Isoform 4:
Sequence conflict2381T → I in BAG52717. Ref.3

Secondary structure

............. 506
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 11, 2011. Version 2.
Checksum: DC9A6DF5B9C2AED0

FASTA50657,660
        10         20         30         40         50         60 
MRDPLTDCPY NKVYKNLKEF SQNGENFCKQ VTSVLQQRAN LEISYAKGLQ KLASKLSKAL 

        70         80         90        100        110        120 
QNTRKSCVSS AWAWASEGMK STADLHQKLG KAIELEAIKP TYQVLNVQEK KRKSLDNEVE 

       130        140        150        160        170        180 
KTANLVISNW NQQIKAKKKL MVSTKKHEAL FQLVESSKQS MTEKEKRKLL NKLTKSTEKL 

       190        200        210        220        230        240 
EKEDENYYQK NMAGYSTRLK WENTLENCYQ SILELEKERI QLLCNNLNQY SQHISLFGQT 

       250        260        270        280        290        300 
LTTCHTQIHC AISKIDIEKD IQAVMEETAI LSTENKSEFL LTDYFEEDPN SAMDKERRKS 

       310        320        330        340        350        360 
LLKPKLLRLQ RDIEKASKDK EGLERMLKTY SSTSSFSDAK SQKDTAALMD ENNLKLDLLE 

       370        380        390        400        410        420 
ANSYKLSSML AELEQRPQPS HPCSNSIFRW REKEHTHSYV KISRPFLMKR LENIVSKASS 

       430        440        450        460        470        480 
GGQSNPGSST PAPGAAQLSS RLCKALYSFQ ARQDDELNLE KGDIVIIHEK KEGGWWFGSL 

       490        500 
NGKKGHFPAA YVEELPSNAG NTATKA 

« Hide

Isoform 2 [UniParc].

Checksum: E8E6E3B37569F432
Show »

FASTA47854,547
Isoform 3 [UniParc].

Checksum: 8819706D71DAC60C
Show »

FASTA42848,876
Isoform 4 [UniParc].

Checksum: 6FE667B285DD4D54
Show »

FASTA56364,364

References

« Hide 'large scale' references
[1]"NOSTRIN: a protein modulating nitric oxide release and subcellular distribution of endothelial nitric oxide synthase."
Zimmermann K., Opitz N., Dedio J., Renne C., Mueller-Esterl W., Oess S.
Proc. Natl. Acad. Sci. U.S.A. 99:17167-17172(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, INTERACTION WITH NOS3, SUBCELLULAR LOCATION, FUNCTION, VARIANT GLU-473.
Tissue: Placenta.
[2]"Molecular characterization of an alternatively spliced variant of human NOSTRIN."
Beese M., Kirsch T.
Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT GLU-473.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANT GLU-473.
Tissue: Colon, Placenta and Testis.
[4]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT GLU-473.
Tissue: Placenta and Thyroid.
[6]"Full-length cDNA libraries and normalization."
Li W.B., Gruber C., Jessee J., Polayes D.
Submitted (APR-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-304.
Tissue: Placenta.
[7]"Altered gene expression in cerebral capillaries of stroke-prone spontaneously hypertensive rats."
Kirsch T., Wellner M., Luft F.C., Haller H., Lippoldt A.
Brain Res. 910:106-115(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION.
[8]"Expression of endothelial nitric oxide synthase traffic inducer in the placentas of women with pre-eclampsia."
Xiang W., Chen H., Xu X., Zhang M., Jiang R.
Int. J. Gynecol. Obstet. 89:103-107(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[9]"NOSTRIN functions as a homotrimeric adaptor protein facilitating internalization of eNOS."
Icking A., Matt S., Opitz N., Wiesenthal A., Mueller-Esterl W., Schilling K.
J. Cell Sci. 118:5059-5069(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBUNIT, INTERACTION WITH DNM2 AND WASL, SUBCELLULAR LOCATION, FUNCTION.
[10]"FCH/Cdc15 domain determines distinct subcellular localization of NOSTRIN."
Icking A., Schilling K., Wiesenthal A., Opitz N., Mueller-Esterl W.
FEBS Lett. 580:223-228(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION.
[11]"Translocation of endothelial nitric-oxide synthase involves a ternary complex with caveolin-1 and NOSTRIN."
Schilling K., Opitz N., Wiesenthal A., Oess S., Tikkanen R., Mueller-Esterl W., Icking A.
Mol. Biol. Cell 17:3870-3880(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH CAV1, FUNCTION.
[12]"Solution structure of the SH3 domain of human nostrin."
RIKEN structural genomics initiative (RSGI)
Submitted (OCT-2007) to the PDB data bank
Cited for: STRUCTURE BY NMR OF 439-506.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AJ532842 mRNA. Translation: CAD58724.1.
DQ402497 mRNA. Translation: ABD62889.1.
AK002203 mRNA. Translation: BAE46614.1.
AK093444 mRNA. Translation: BAG52717.1.
AK290254 mRNA. Translation: BAF82943.1.
AC069137 Genomic DNA. Translation: AAY24097.1.
AC009475 Genomic DNA. No translation available.
BC014189 mRNA. Translation: AAH14189.1.
BC093072 mRNA. Translation: AAH93072.1.
AL550371 mRNA. No translation available.
CCDSCCDS42771.1. [Q8IVI9-1]
CCDS42772.1. [Q8IVI9-3]
CCDS54415.1. [Q8IVI9-4]
CCDS54416.1. [Q8IVI9-2]
RefSeqNP_001034813.2. NM_001039724.3. [Q8IVI9-1]
NP_001165102.1. NM_001171631.1. [Q8IVI9-4]
NP_001165103.1. NM_001171632.1. [Q8IVI9-2]
NP_443178.2. NM_052946.3. [Q8IVI9-3]
UniGeneHs.189780.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2YUNNMR-A441-506[»]
ProteinModelPortalQ8IVI9.
SMRQ8IVI9. Positions 434-506.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid125446. 4 interactions.
IntActQ8IVI9. 14 interactions.
STRING9606.ENSP00000318921.

PTM databases

PhosphoSiteQ8IVI9.

Polymorphism databases

DMDM317373401.

Proteomic databases

MaxQBQ8IVI9.
PaxDbQ8IVI9.
PRIDEQ8IVI9.

Protocols and materials databases

DNASU115677.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000317647; ENSP00000318921; ENSG00000163072. [Q8IVI9-1]
ENST00000397206; ENSP00000380390; ENSG00000163072. [Q8IVI9-3]
ENST00000397209; ENSP00000380392; ENSG00000163072. [Q8IVI9-2]
ENST00000421711; ENSP00000401316; ENSG00000163072. [Q8IVI9-2]
ENST00000444448; ENSP00000394051; ENSG00000163072. [Q8IVI9-4]
ENST00000445023; ENSP00000404413; ENSG00000163072. [Q8IVI9-3]
ENST00000458381; ENSP00000402140; ENSG00000163072. [Q8IVI9-4]
ENST00000571377; ENSP00000460608; ENSG00000262773.
ENST00000574102; ENSP00000460765; ENSG00000262773.
ENST00000574750; ENSP00000458654; ENSG00000262773.
ENST00000574986; ENSP00000460968; ENSG00000262773.
ENST00000576231; ENSP00000461773; ENSG00000262773.
GeneID115677.
KEGGhsa:115677.
UCSCuc002uef.3. human.
uc002ueg.3. human. [Q8IVI9-1]
uc010fpu.3. human. [Q8IVI9-2]

Organism-specific databases

CTD115677.
GeneCardsGC02P169643.
HGNCHGNC:20203. NOSTRIN.
HPAHPA044384.
MIM607496. gene.
neXtProtNX_Q8IVI9.
PharmGKBPA134992787.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG266189.
HOGENOMHOG000113830.
HOVERGENHBG101730.
InParanoidQ8IVI9.
OMAHIREMLL.
PhylomeDBQ8IVI9.

Enzyme and pathway databases

ReactomeREACT_111217. Metabolism.

Gene expression databases

ArrayExpressQ8IVI9.
BgeeQ8IVI9.
CleanExHS_NOSTRIN.
GenevestigatorQ8IVI9.

Family and domain databases

InterProIPR001060. FCH_dom.
IPR011072. HR1_rho-bd.
IPR028535. Nostrin.
IPR001452. SH3_domain.
[Graphical view]
PANTHERPTHR14167:SF22. PTHR14167:SF22. 1 hit.
PfamPF00611. FCH. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view]
PRINTSPR00452. SH3DOMAIN.
SMARTSM00326. SH3. 1 hit.
[Graphical view]
SUPFAMSSF46585. SSF46585. 1 hit.
SSF50044. SSF50044. 1 hit.
PROSITEPS50133. FCH. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceQ8IVI9.
GenomeRNAi115677.
NextBio79640.
PROQ8IVI9.
SOURCESearch...

Entry information

Entry nameNOSTN_HUMAN
AccessionPrimary (citable) accession number: Q8IVI9
Secondary accession number(s): A8K2I9 expand/collapse secondary AC list , B3KSF5, E7EPT9, Q27HG3, Q53S62, Q96CJ9
Entry history
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: January 11, 2011
Last modified: July 9, 2014
This is version 114 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM