Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

T-lymphoma invasion and metastasis-inducing protein 2

Gene

TIAM2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Modulates the activity of RHO-like proteins and connects extracellular signals to cytoskeletal activities. Acts as a GDP-dissociation stimulator protein that stimulates the GDP-GTP exchange activity of RHO-like GTPases and activates them. Mediates extracellular laminin signals to activate Rac1, contributing to neurite growth. Involved in lamellipodial formation and advancement of the growth cone of embryonic hippocampal neurons. Promotes migration of neurons in the cerebral cortex. When overexpressed, induces membrane ruffling accompanied by the accumulation of actin filaments along the altered plasma membrane (By similarity). Activates specifically RAC1, but not CDC42 and RHOA.By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Enzyme and pathway databases

ReactomeiR-HSA-193648. NRAGE signals death through JNK.
R-HSA-194840. Rho GTPase cycle.
R-HSA-1989781. PPARA activates gene expression.
R-HSA-416482. G alpha (12/13) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
T-lymphoma invasion and metastasis-inducing protein 2
Short name:
TIAM-2
Alternative name(s):
SIF and TIAM1-like exchange factor
Gene namesi
Name:TIAM2
Synonyms:KIAA2016, STEF
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:11806. TIAM2.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: Reactome
  • extracellular exosome Source: UniProtKB
  • filopodium Source: UniProtKB-SubCell
  • growth cone Source: UniProtKB-SubCell
  • lamellipodium Source: UniProtKB-SubCell
  • membrane Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA36515.

Polymorphism and mutation databases

BioMutaiTIAM2.
DMDMi296453025.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methionineiRemovedSequence analysis
Chaini2 – 17011700T-lymphoma invasion and metastasis-inducing protein 2PRO_0000317467Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Lipidationi2 – 21N-myristoyl glycineSequence analysis
Modified residuei1583 – 15831PhosphoserineBy similarity
Modified residuei1648 – 16481PhosphothreonineBy similarity

Post-translational modificationi

Phosphorylated on serine and threonine residues. Phosphorylated on Thr-1648 by Rho-kinase. Its phosphorylation by Rho-kinase inhibits its guanine nucleotide exchange activity, its interaction with MAP1A, MAP1B, PARP1 and YWHAE and reduces its ability to promote neurite growth (By similarity).By similarity

Keywords - PTMi

Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

MaxQBiQ8IVF5.
PaxDbiQ8IVF5.
PRIDEiQ8IVF5.

PTM databases

iPTMnetiQ8IVF5.

Expressioni

Tissue specificityi

Expressed in the occipital, frontal and temporal lobes, cerebellum, putamen and testis.1 Publication

Gene expression databases

BgeeiQ8IVF5.
CleanExiHS_TIAM2.
ExpressionAtlasiQ8IVF5. baseline and differential.
GenevisibleiQ8IVF5. HS.

Organism-specific databases

HPAiHPA011134.
HPA013903.

Interactioni

Subunit structurei

Interacts with MAP1A, MAP1B, PARP1 and YWHAE. Interacts with CD44, PARD3 and MAPK8IP2 (By similarity).By similarity

Protein-protein interaction databases

BioGridi117621. 9 interactions.
IntActiQ8IVF5. 6 interactions.
MINTiMINT-6776496.
STRINGi9606.ENSP00000327315.

Structurei

3D structure databases

ProteinModelPortaliQ8IVF5.
SMRiQ8IVF5. Positions 506-743, 1094-1461.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini506 – 620115PH 1PROSITE-ProRule annotationAdd
BLAST
Domaini810 – 88172RBDPROSITE-ProRule annotationAdd
BLAST
Domaini890 – 97687PDZPROSITE-ProRule annotationAdd
BLAST
Domaini1099 – 1293195DHPROSITE-ProRule annotationAdd
BLAST
Domaini1347 – 1478132PH 2PROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili628 – 69568Sequence analysisAdd
BLAST

Domaini

The PH 1 domain and amino acids 621-782 (a region called TSS; otherwise known as CC-Ex) are necessary for membrane localization. The PH 1 and TSS domains are necessary for Rac1 activity. The PH 2 domain is engaged in the enhancement of the catalytic activity of the adjacent DH domain. The PH 1, TSS and DH domains are necessary to induce neurite-like structure (By similarity).By similarity

Sequence similaritiesi

Belongs to the TIAM family.Curated
Contains 1 DH (DBL-homology) domain.PROSITE-ProRule annotation
Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation
Contains 2 PH domains.PROSITE-ProRule annotation
Contains 1 RBD (Ras-binding) domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiENOG410ITS1. Eukaryota.
ENOG410XPCM. LUCA.
GeneTreeiENSGT00760000118925.
HOVERGENiHBG059279.
InParanoidiQ8IVF5.
KOiK16847.
OMAiFNTLETP.
OrthoDBiEOG7F24RZ.
PhylomeDBiQ8IVF5.
TreeFamiTF319686.

Family and domain databases

Gene3Di1.20.900.10. 1 hit.
2.30.29.30. 2 hits.
2.30.42.10. 1 hit.
InterProiIPR000219. DH-domain.
IPR001331. GDS_CDC24_CS.
IPR001478. PDZ.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR003116. RBD_dom.
[Graphical view]
PfamiPF00595. PDZ. 1 hit.
PF00169. PH. 1 hit.
PF00621. RhoGEF. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 1 hit.
SM00233. PH. 2 hits.
SM00455. RBD. 1 hit.
SM00325. RhoGEF. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
SSF50156. SSF50156. 1 hit.
SSF50729. SSF50729. 2 hits.
PROSITEiPS00741. DH_1. 1 hit.
PS50010. DH_2. 1 hit.
PS50106. PDZ. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50898. RBD. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8IVF5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGNSDSQYTL QGSKNHSNTI TGAKQIPCSL KIRGIHAKEE KSLHGWGHGS
60 70 80 90 100
NGAGYKSRSL ARSCLSHFKS NQPYASRLGG PTCKVSRGVA YSTHRTNAPG
110 120 130 140 150
KDFQGISAAF STENGFHSVG HELADNHITS RDCNGHLLNC YGRNESIAST
160 170 180 190 200
PPGEDRKSPR VLIKTLGKLD GCLRVEFHNG GNPSKVPAED CSEPVQLLRY
210 220 230 240 250
SPTLASETSP VPEARRGSSA DSLPSHRPSP TDSRLRSSKG SSLSSESSWY
260 270 280 290 300
DSPWGNAGEL SEAEGSFLAP GMPDPSLHAS FPPGDAKKPF NQSSSLSSLR
310 320 330 340 350
ELYKDANLGS LSPSGIRLSD EYMGTHASLS NRVSFASDID VPSRVAHGDP
360 370 380 390 400
IQYSSFTLPC RKPKAFVEDT AKKDSLKARM RRISDWTGSL SRKKRKLQEP
410 420 430 440 450
RSKEGSDYFD SRSDGLNTDV QGSSQASAFL WSGGSTQILS QRSESTHAIG
460 470 480 490 500
SDPLRQNIYE NFMRELEMSR TNTENIETST ETAESSSESL SSLEQLDLLF
510 520 530 540 550
EKEQGVVRKA GWLFFKPLVT VQKERKLELV ARRKWKQYWV TLKGCTLLFY
560 570 580 590 600
ETYGKNSMDQ SSAPRCALFA EDSIVQSVPE HPKKENVFCL SNSFGDVYLF
610 620 630 640 650
QATSQTDLEN WVTAVHSACA SLFAKKHGKE DTLRLLKNQT KNLLQKIDMD
660 670 680 690 700
SKMKKMAELQ LSVVSDPKNR KAIENQIQQW EQNLEKFHMD LFRMRCYLAS
710 720 730 740 750
LQGGELPNPK SLLAAASRPS KLALGRLGIL SVSSFHALVC SRDDSALRKR
760 770 780 790 800
TLSLTQRGRN KKGIFSSLKG LDTLARKGKE KRPSITQVDE LLHIYGSTVD
810 820 830 840 850
GVPRDNAWEI QTYVHFQDNH GVTVGIKPEH RVEDILTLAC KMRQLEPSHY
860 870 880 890 900
GLQLRKLVDD NVEYCIPAPY EYMQQQVYDE IEVFPLNVYD VQLTKTGSVC
910 920 930 940 950
DFGFAVTAQV DERQHLSRIF ISDVLPDGLA YGEGLRKGNE IMTLNGEAVS
960 970 980 990 1000
DLDLKQMEAL FSEKSVGLTL IARPPDTKAT LCTSWSDSDL FSRDQKSLLP
1010 1020 1030 1040 1050
PPNQSQLLEE FLDNFKKNTA NDFSNVPDIT TGLKRSQTDG TLDQVSHREK
1060 1070 1080 1090 1100
MEQTFRSAEQ ITALCRSFND SQANGMEGPR ENQDPPPRSL ARHLSDADRL
1110 1120 1130 1140 1150
RKVIQELVDT EKSYVKDLSC LFELYLEPLQ NETFLTQDEM ESLFGSLPEM
1160 1170 1180 1190 1200
LEFQKVFLET LEDGISASSD FNTLETPSQF RKLLFSLGGS FLYYADHFKL
1210 1220 1230 1240 1250
YSGFCANHIK VQKVLERAKT DKAFKAFLDA RNPTKQHSST LESYLIKPVQ
1260 1270 1280 1290 1300
RVLKYPLLLK ELVSLTDQES EEHYHLTEAL KAMEKVASHI NEMQKIYEDY
1310 1320 1330 1340 1350
GTVFDQLVAE QSGTEKEVTE LSMGELLMHS TVSWLNPFLS LGKARKDLEL
1360 1370 1380 1390 1400
TVFVFKRAVI LVYKENCKLK KKLPSNSRPA HNSTDLDPFK FRWLIPISAL
1410 1420 1430 1440 1450
QVRLGNPAGT ENNSIWELIH TKSEIEGRPE TIFQLCCSDS ESKTNIVKVI
1460 1470 1480 1490 1500
RSILRENFRR HIKCELPLEK TCKDRLVPLK NRVPVSAKLA SSRSLKVLKN
1510 1520 1530 1540 1550
SSSNEWTGET GKGTLLDSDE GSLSSGTQSS GCPTAEGRQD SKSTSPGKYP
1560 1570 1580 1590 1600
HPGLADFADN LIKESDILSD EDDDHRQTVK QGSPTKDIEI QFQRLRISED
1610 1620 1630 1640 1650
PDVHPEAEQQ PGPESGEGQK GGEQPKLVRG HFCPIKRKAN STKRDRGTLL
1660 1670 1680 1690 1700
KAQIRHQSLD SQSENATIDL NSVLEREFSV QSLTSVVSEE CFYETESHGK

S
Length:1,701
Mass (Da):190,103
Last modified:May 18, 2010 - v4
Checksum:iC2C9C9B1782B7823
GO
Isoform 2 (identifier: Q8IVF5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1317-1317: E → EQPEWSSEVMDVLDPRGKLTKGTLEEPRTL

Show »
Length:1,730
Mass (Da):193,398
Checksum:i05CE6315772C1B90
GO
Isoform 3 (identifier: Q8IVF5-3) [UniParc]FASTAAdd to basket

Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     1-1075: Missing.

Show »
Length:626
Mass (Da):70,774
Checksum:i782D90DF706BEC02
GO
Isoform 4 (identifier: Q8IVF5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-688: Missing.

Show »
Length:1,013
Mass (Da):114,079
Checksum:iD7C1B5D6B346E3D9
GO
Isoform 5 (identifier: Q8IVF5-5) [UniParc]FASTAAdd to basket

Also known as: Long

The sequence of this isoform differs from the canonical sequence as follows:
     787-787: Q → QIFDSSGSHGFSGTQLPQNSSNSSE

Show »
Length:1,725
Mass (Da):192,555
Checksum:iA836FE578E412A5C
GO

Sequence cautioni

The sequence AAF05900.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAC23112.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAC86170.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti506 – 5061V → A in BAC86170 (PubMed:14702039).Curated
Sequence conflicti633 – 6331L → P in AAF05900 (PubMed:10512681).Curated
Sequence conflicti722 – 7221L → P in AAF05900 (PubMed:10512681).Curated
Sequence conflicti807 – 8071A → T in AAF05900 (PubMed:10512681).Curated
Sequence conflicti1066 – 10661R → K in BAC86170 (PubMed:14702039).Curated
Sequence conflicti1092 – 10921R → G in AAH66979 (PubMed:15489334).Curated
Sequence conflicti1154 – 11541Q → R in AAH66979 (PubMed:15489334).Curated
Sequence conflicti1186 – 11861S → P in BAC86170 (PubMed:14702039).Curated
Sequence conflicti1306 – 13061Q → R in BAC86170 (PubMed:14702039).Curated
Sequence conflicti1365 – 13651E → K in BAC86170 (PubMed:14702039).Curated
Sequence conflicti1376 – 13761N → Y in AAH66979 (PubMed:15489334).Curated
Sequence conflicti1451 – 14511R → S in AAH66979 (PubMed:15489334).Curated
Sequence conflicti1482 – 14821R → G in AAH66979 (PubMed:15489334).Curated
Sequence conflicti1519 – 15191D → Y in BAC86170 (PubMed:14702039).Curated
Sequence conflicti1639 – 16391A → T in BAC86170 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti332 – 3321R → H.
Corresponds to variant rs931312 [ dbSNP | Ensembl ].
VAR_051994
Natural varianti913 – 9131R → H.
Corresponds to variant rs7770537 [ dbSNP | Ensembl ].
VAR_051995
Natural varianti1089 – 10891S → P.5 Publications
Corresponds to variant rs4259257 [ dbSNP | Ensembl ].
VAR_051996
Natural varianti1101 – 11011R → C.
Corresponds to variant rs11751128 [ dbSNP | Ensembl ].
VAR_038534
Natural varianti1572 – 15721D → E.
Corresponds to variant rs1571767 [ dbSNP | Ensembl ].
VAR_038535

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 10751075Missing in isoform 3. 2 PublicationsVSP_030971Add
BLAST
Alternative sequencei1 – 688688Missing in isoform 4. 1 PublicationVSP_030972Add
BLAST
Alternative sequencei787 – 7871Q → QIFDSSGSHGFSGTQLPQNS SNSSE in isoform 5. 1 PublicationVSP_030974
Alternative sequencei1317 – 13171E → EQPEWSSEVMDVLDPRGKLT KGTLEEPRTL in isoform 2. 1 PublicationVSP_030975

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF120323 mRNA. Translation: AAF05900.1. Different initiation.
AF120324 mRNA. Translation: AAF05901.1.
AB095936 mRNA. Translation: BAC23112.2. Different initiation.
AL122086 mRNA. Translation: CAB59259.2.
AL139101 Genomic DNA. No translation available.
AL355343 Genomic DNA. No translation available.
AL596202 Genomic DNA. No translation available.
CH471051 Genomic DNA. Translation: EAW47693.1.
BC066979 mRNA. Translation: AAH66979.1.
BC137275 mRNA. Translation: AAI37276.1.
AK125459 mRNA. Translation: BAC86170.1. Different initiation.
CCDSiCCDS34558.1. [Q8IVF5-1]
CCDS34559.1. [Q8IVF5-3]
RefSeqiNP_001010927.1. NM_001010927.2.
NP_036586.2. NM_012454.3.
UniGeneiHs.586279.

Genome annotation databases

EnsembliENST00000275246; ENSP00000275246; ENSG00000146426. [Q8IVF5-3]
ENST00000318981; ENSP00000327315; ENSG00000146426. [Q8IVF5-1]
ENST00000360366; ENSP00000353528; ENSG00000146426. [Q8IVF5-5]
ENST00000456877; ENSP00000407183; ENSG00000146426. [Q8IVF5-4]
ENST00000461783; ENSP00000437188; ENSG00000146426. [Q8IVF5-1]
ENST00000529824; ENSP00000433348; ENSG00000146426. [Q8IVF5-2]
GeneIDi26230.
KEGGihsa:26230.
UCSCiuc003qqb.3. human. [Q8IVF5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF120323 mRNA. Translation: AAF05900.1. Different initiation.
AF120324 mRNA. Translation: AAF05901.1.
AB095936 mRNA. Translation: BAC23112.2. Different initiation.
AL122086 mRNA. Translation: CAB59259.2.
AL139101 Genomic DNA. No translation available.
AL355343 Genomic DNA. No translation available.
AL596202 Genomic DNA. No translation available.
CH471051 Genomic DNA. Translation: EAW47693.1.
BC066979 mRNA. Translation: AAH66979.1.
BC137275 mRNA. Translation: AAI37276.1.
AK125459 mRNA. Translation: BAC86170.1. Different initiation.
CCDSiCCDS34558.1. [Q8IVF5-1]
CCDS34559.1. [Q8IVF5-3]
RefSeqiNP_001010927.1. NM_001010927.2.
NP_036586.2. NM_012454.3.
UniGeneiHs.586279.

3D structure databases

ProteinModelPortaliQ8IVF5.
SMRiQ8IVF5. Positions 506-743, 1094-1461.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117621. 9 interactions.
IntActiQ8IVF5. 6 interactions.
MINTiMINT-6776496.
STRINGi9606.ENSP00000327315.

PTM databases

iPTMnetiQ8IVF5.

Polymorphism and mutation databases

BioMutaiTIAM2.
DMDMi296453025.

Proteomic databases

MaxQBiQ8IVF5.
PaxDbiQ8IVF5.
PRIDEiQ8IVF5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000275246; ENSP00000275246; ENSG00000146426. [Q8IVF5-3]
ENST00000318981; ENSP00000327315; ENSG00000146426. [Q8IVF5-1]
ENST00000360366; ENSP00000353528; ENSG00000146426. [Q8IVF5-5]
ENST00000456877; ENSP00000407183; ENSG00000146426. [Q8IVF5-4]
ENST00000461783; ENSP00000437188; ENSG00000146426. [Q8IVF5-1]
ENST00000529824; ENSP00000433348; ENSG00000146426. [Q8IVF5-2]
GeneIDi26230.
KEGGihsa:26230.
UCSCiuc003qqb.3. human. [Q8IVF5-1]

Organism-specific databases

CTDi26230.
GeneCardsiTIAM2.
H-InvDBHIX0122219.
HGNCiHGNC:11806. TIAM2.
HPAiHPA011134.
HPA013903.
MIMi604709. gene.
neXtProtiNX_Q8IVF5.
PharmGKBiPA36515.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410ITS1. Eukaryota.
ENOG410XPCM. LUCA.
GeneTreeiENSGT00760000118925.
HOVERGENiHBG059279.
InParanoidiQ8IVF5.
KOiK16847.
OMAiFNTLETP.
OrthoDBiEOG7F24RZ.
PhylomeDBiQ8IVF5.
TreeFamiTF319686.

Enzyme and pathway databases

ReactomeiR-HSA-193648. NRAGE signals death through JNK.
R-HSA-194840. Rho GTPase cycle.
R-HSA-1989781. PPARA activates gene expression.
R-HSA-416482. G alpha (12/13) signalling events.

Miscellaneous databases

ChiTaRSiTIAM2. human.
GenomeRNAii26230.
NextBioi48395.
PROiQ8IVF5.
SOURCEiSearch...

Gene expression databases

BgeeiQ8IVF5.
CleanExiHS_TIAM2.
ExpressionAtlasiQ8IVF5. baseline and differential.
GenevisibleiQ8IVF5. HS.

Family and domain databases

Gene3Di1.20.900.10. 1 hit.
2.30.29.30. 2 hits.
2.30.42.10. 1 hit.
InterProiIPR000219. DH-domain.
IPR001331. GDS_CDC24_CS.
IPR001478. PDZ.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR003116. RBD_dom.
[Graphical view]
PfamiPF00595. PDZ. 1 hit.
PF00169. PH. 1 hit.
PF00621. RhoGEF. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 1 hit.
SM00233. PH. 2 hits.
SM00455. RBD. 1 hit.
SM00325. RhoGEF. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
SSF50156. SSF50156. 1 hit.
SSF50729. SSF50729. 2 hits.
PROSITEiPS00741. DH_1. 1 hit.
PS50010. DH_2. 1 hit.
PS50106. PDZ. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50898. RBD. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of T-cell lymphoma invasion and metastasis 2 (TIAM2), a novel guanine nucleotide exchange factor related to TIAM1."
    Chiu C.-Y., Leng S., Martin K.A., Kim E., Gorman S., Duhl D.M.
    Genomics 61:66-73(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [MRNA] OF 634-1701 (ISOFORM 5), FUNCTION, TISSUE SPECIFICITY, VARIANT PRO-1089.
  2. "The nucleotide sequence of a long cDNA clone isolated from human."
    Nagase T., Kikuno R., Ohara O.
    Submitted (NOV-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-1089.
    Tissue: Brain.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT PRO-1089.
    Tissue: Testis.
  4. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT PRO-1089.
    Tissue: Brain.
  7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 446-1701 (ISOFORM 2), VARIANT PRO-1089.
    Tissue: Fetal brain.

Entry informationi

Entry nameiTIAM2_HUMAN
AccessioniPrimary (citable) accession number: Q8IVF5
Secondary accession number(s): B2RP56
, C9JZV2, Q6NXN9, Q6ZUP9, Q9UFG6, Q9UKV9, Q9UKW0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: May 18, 2010
Last modified: May 11, 2016
This is version 112 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.