Q8IV77 (CNGA4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 81.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cyclic nucleotide-gated cation channel alpha-4 Alternative name(s): Cyclic nucleotide-gated channel alpha-4 Short name=CNG channel alpha-4 Short name=CNG-4 Short name=CNG4 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 575 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Second messenger, cAMP, causes the opening of cation-selective cyclic nucleotide-gated (CNG) channels and depolarization of the neuron (olfactory sensory neurons, OSNs). CNGA4 is the modulatory subunit of this channel which is known to play a central role in the transduction of odorant signals and subsequent adaptation. By accelerating the calcium-mediated negative feedback in olfactory signaling it allows rapid adaptation to odor stimulation and extends its range of odor detection By similarity. |
| Enzyme regulation | Calcium-calmodulin exerts its inhibitory effect in cAMP sensitivity by binding to IQ-like motif of CNGA4 and preferably binds to the channel in the closed state. Inhibition by PIP3 of the CNG channel probably occurs via CGNA2 binding. Ref.5 |
| Subunit structure | Heterotetramer composed of two subunits of CNGA2, one of CNGA4 and one of CNGB1b. The complex forms the cyclic nucleotide-gated (CNG) channel of olfactory sensory neurons. Ref.4 |
| Subcellular location | Membrane; Multi-pass membrane protein Potential. |
| Domain | The C-terminal coiled-coil domain mediates trimerization of CNGA subunits By similarity. |
| Sequence similarities | Belongs to the cyclic nucleotide-gated cation channel (TC 1.A.1.5) family. CNGA4 subfamily. [View classification] Contains 1 cyclic nucleotide-binding domain. |
| Sequence caution | The sequence AAH40277.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence AK122736 differs from that shown. Reason: Frameshift at position 154. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ion transport Olfaction Sensory transduction Transport |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil Transmembrane Transmembrane helix |
| Ligand | Nucleotide-binding cAMP cAMP-binding |
| Molecular function | Ion channel Ligand-gated ion channel |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | response to stimulus Inferred from electronic annotation. Source: UniProtKB-KW sensory perception of smellInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | cAMP binding Inferred from electronic annotation. Source: UniProtKB-KW ion channel activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8IV77-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8IV77-2) The sequence of this isoform differs from the canonical sequence as follows: 1-40: Missing. 424-456: NMSGNRRTANIKSLGYSDLFCLSKEDLREVLSE → GYPSICSRDKDGWGRGEQQSPVLGPDSTSGLNF 457-575: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 575 | 575 | Cyclic nucleotide-gated cation channel alpha-4 | PRO_0000317107 | |||||
Regions | |||||||||
| Topological domain | 1 – 33 | 33 | Cytoplasmic Potential | ||||||
| Transmembrane | 34 – 54 | 21 | Helical; Name=H1; Potential | ||||||
| Topological domain | 55 – 65 | 11 | Extracellular Potential | ||||||
| Transmembrane | 66 – 86 | 21 | Helical; Name=H2; Potential | ||||||
| Topological domain | 87 – 112 | 26 | Cytoplasmic Potential | ||||||
| Transmembrane | 113 – 133 | 21 | Helical; Name=H3; Potential | ||||||
| Topological domain | 134 – 168 | 35 | Extracellular Potential | ||||||
| Transmembrane | 169 – 189 | 21 | Helical; Name=H4; Potential | ||||||
| Topological domain | 190 – 217 | 28 | Cytoplasmic Potential | ||||||
| Transmembrane | 218 – 234 | 17 | Helical; Name=H5; Potential | ||||||
| Topological domain | 235 – 244 | 10 | Extracellular Potential | ||||||
| Transmembrane | 245 – 265 | 21 | Helical; Name=H6; Potential | ||||||
| Topological domain | 266 – 575 | 310 | Cytoplasmic Potential | ||||||
| Nucleotide binding | 348 – 471 | 124 | cNMP | ||||||
| Coiled coil | 493 – 536 | 44 | By similarity | ||||||
| Motif | 292 – 302 | 11 | IQ-type | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 40 | 40 | Missing in isoform 2. | VSP_039919 | |||||
| Alternative sequence | 424 – 456 | 33 | NMSGN…EVLSE → GYPSICSRDKDGWGRGEQQS PVLGPDSTSGLNF in isoform 2. | VSP_039920 | |||||
| Alternative sequence | 457 – 575 | 119 | Missing in isoform 2. | VSP_039921 | |||||
| Natural variant | 553 | 1 | E → V. Corresponds to variant rs325706 [ dbSNP | Ensembl ]. | VAR_038480 | |||||
Experimental info | |||||||||
| Mutagenesis | 292 | 1 | L → E: Loss of inhibition produced by calcium/calmodulin binding. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [2] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain and Lung. |
| [4] | "Calmodulin permanently associates with rat olfactory CNG channels under native conditions." Bradley J., Boenigk W., Yau K.-W., Frings S. Nat. Neurosci. 7:705-710(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SUBUNIT, MUTAGENESIS OF LEU-292. |
| [5] | "Interplay between PIP3 and calmodulin regulation of olfactory cyclic nucleotide-gated channels." Brady J.D., Rich E.D., Martens J.R., Karpen J.W., Varnum M.D., Brown R.L. Proc. Natl. Acad. Sci. U.S.A. 103:15635-15640(2006) [PubMed] [Europe PMC] [Abstract] Cited for: ENZYME REGULATION. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK122736 mRNA. No translation available. AC022762 Genomic DNA. No translation available. BC040277 mRNA. Translation: AAH40277.1. Different initiation. BC106935 mRNA. No translation available. BC106936 mRNA. No translation available. |
| IPI | IPI00216905. IPI00970995. |
| RefSeq | NP_001032406.1. NM_001037329.3. |
| UniGene | Hs.434618. |
3D structure databases | |
| ProteinModelPortal | Q8IV77. |
| SMR | Q8IV77. Positions 286-465. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000369268. |
Polymorphism databases | |
| DMDM | 311033466. |
Proteomic databases | |
| PaxDb | Q8IV77. |
| PRIDE | Q8IV77. |
Protocols and materials databases | |
| DNASU | 1262. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000379936; ENSP00000369268; ENSG00000132259. |
| GeneID | 1262. |
| KEGG | hsa:1262. |
| UCSC | uc001mcn.3. human. uc001mco.3. human. |
Organism-specific databases | |
| CTD | 1262. |
| GeneCards | GC11P006255. |
| H-InvDB | HIX0026152. |
| HGNC | HGNC:2152. CNGA4. |
| MIM | 609472. gene. |
| neXtProt | NX_Q8IV77. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG300831. |
| HOGENOM | HOG000007898. |
| HOVERGEN | HBG000281. |
| InParanoid | Q8IV77. |
| KO | K04951. |
| OMA | VGHEMYI. |
| OrthoDB | EOG4229JG. |
Gene expression databases | |
| ArrayExpress | Q8IV77. |
| Bgee | Q8IV77. |
| CleanEx | HS_CNGA4. |
| Genevestigator | Q8IV77. |
Family and domain databases | |
| Gene3D | 2.60.120.10. 1 hit. |
| InterPro | IPR018490. cNMP-bd-like. IPR018488. cNMP-bd_CS. IPR000595. cNMP-bd_dom. IPR005821. Ion_trans_dom. IPR014710. RmlC-like_jellyroll. [Graphical view] |
| Pfam | PF00027. cNMP_binding. 1 hit. PF00520. Ion_trans. 1 hit. [Graphical view] |
| SMART | SM00100. cNMP. 1 hit. [Graphical view] |
| SUPFAM | SSF51206. cNMP_binding. 1 hit. |
| PROSITE | PS00888. CNMP_BINDING_1. 1 hit. PS00889. CNMP_BINDING_2. 1 hit. PS50042. CNMP_BINDING_3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 1262. |
| NextBio | 5107. |
| SOURCE | Search... |
Entry information
| Entry name | CNGA4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8IV77 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
