SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8IUR5

- TMTC1_HUMAN

UniProt

Q8IUR5 - TMTC1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Transmembrane and TPR repeat-containing protein 1
Gene
TMTC1, ARG99
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Transmembrane and TPR repeat-containing protein 1
Gene namesi
Name:TMTC1
ORF Names:ARG99
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:24099. TMTC1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei21 – 4121Helical; Reviewed prediction
Add
BLAST
Transmembranei111 – 13121Helical; Reviewed prediction
Add
BLAST
Transmembranei161 – 18121Helical; Reviewed prediction
Add
BLAST
Transmembranei198 – 21821Helical; Reviewed prediction
Add
BLAST
Transmembranei314 – 33421Helical; Reviewed prediction
Add
BLAST
Transmembranei355 – 37521Helical; Reviewed prediction
Add
BLAST
Transmembranei382 – 40221Helical; Reviewed prediction
Add
BLAST
Transmembranei404 – 42421Helical; Reviewed prediction
Add
BLAST
Transmembranei439 – 45921Helical; Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. mitochondrion Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142670718.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 882882Transmembrane and TPR repeat-containing protein 1
PRO_0000280288Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi184 – 1841N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ8IUR5.
PRIDEiQ8IUR5.

PTM databases

PhosphoSiteiQ8IUR5.

Expressioni

Gene expression databases

ArrayExpressiQ8IUR5.
BgeeiQ8IUR5.
CleanExiHS_TMTC1.
GenevestigatoriQ8IUR5.

Organism-specific databases

HPAiHPA016720.

Interactioni

Subunit structurei

May interact with FAM168B.

Protein-protein interaction databases

IntActiQ8IUR5. 2 interactions.
MINTiMINT-8383569.
STRINGi9606.ENSP00000256062.

Structurei

3D structure databases

ProteinModelPortaliQ8IUR5.
SMRiQ8IUR5. Positions 461-856.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati483 – 51634TPR 1
Add
BLAST
Repeati518 – 54730TPR 2
Add
BLAST
Repeati548 – 58134TPR 3
Add
BLAST
Repeati583 – 61533TPR 4
Add
BLAST
Repeati616 – 64934TPR 5
Add
BLAST
Repeati650 – 68334TPR 6
Add
BLAST
Repeati684 – 71633TPR 7
Add
BLAST
Repeati751 – 78434TPR 8
Add
BLAST
Repeati789 – 82234TPR 9
Add
BLAST
Repeati823 – 85634TPR 10
Add
BLAST

Sequence similaritiesi

Belongs to the TMTC family.
Contains 10 TPR repeats.

Keywords - Domaini

Repeat, TPR repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0457.
HOVERGENiHBG106148.
InParanoidiQ8IUR5.
OrthoDBiEOG72RMXM.
PhylomeDBiQ8IUR5.
TreeFamiTF328339.

Family and domain databases

Gene3Di1.25.40.10. 4 hits.
InterProiIPR013618. DUF1736.
IPR013026. TPR-contain_dom.
IPR011990. TPR-like_helical.
IPR001440. TPR_1.
IPR019734. TPR_repeat.
[Graphical view]
PfamiPF08409. DUF1736. 1 hit.
PF00515. TPR_1. 3 hits.
[Graphical view]
SMARTiSM00028. TPR. 10 hits.
[Graphical view]
PROSITEiPS50005. TPR. 10 hits.
PS50293. TPR_REGION. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 5 (identifier: Q8IUR5-5) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MVVTTSARGG GGDRTPSRRR GCGLAPAGAA ALLAGASCLC YGRSLQGEFV    50
HDDVWAIVNN PDVRPGAPLR WGIFTNDFWG KGMAENTSHK SYRPLCVLTF 100
KLNIFLTGMN PFYFHAVNII LHCLVTLVLM YTCDKTVFKN RGLAFVTALL 150
FAVHPIHTEA VAGIVGRADV LACLLFLLAF LSYNRSLDQG CVGGSFPSTV 200
SPFFLLLSLF LGTCAMLVKE TGITVFGVCL VYDLFSLSNK QDKSSNGALC 250
PRSPQQPGSP QPSSLPGHPH RENGKQQRFP HKGAWGGCHS PLPPEPKSSG 300
FPVSPRAVWS MMRFLTYSYL LAFNVWLLLA PVTLCYDWQV GSIPLVETIW 350
DMRNLATIFL AVVMALLSLH CLAAFKRLEH KEVLVGLLFL VFPFIPASNL 400
FFRVGFVVAE RVLYMPSMGY CILFVHGLSK LCTWLNRCGA TTLIVSTVLL 450
LLLFSWKTVK QNEIWLSRES LFRSGVQTLP HNAKVHYNYA NFLKDQGRNK 500
EAIYHYRTAL KLYPRHASAL NNLGTLTRDT AEAKMYYQRA LQLHPQHNRA 550
LFNLGNLLKS QEKKEEAITL LKDSIKYGPE FADAYSSLAS LLAEQERFKE 600
AEEIYQTGIK NCPDSSDLHN NYGVFLVDTG LPEKAVAHYQ QAIKLSPSHH 650
VAMVNLGRLY RSLGENSMAE EWYKRALQVA HKAEILSPLG ALYYNTGRYE 700
EALQIYQEAA ALQPSQRELR LALAQVLAVM GQTKEAEKMT NHIVSEETGC 750
LECYRLLSAI YSKQENHDKA LDAIDKALQL KPKDPKVISE LFFTKGNQLR 800
EQNLLDKAFE SYRVAVQLNP DQAQAWMNMG GIQHIKGKYV SARAYYERAL 850
QLVPDSKLLK ENLAKLDRLE KRLQEVREKD QT 882
Length:882
Mass (Da):98,847
Last modified:September 21, 2011 - v3
Checksum:i5E4E0B1453C8AAC0
GO
Isoform 1 (identifier: Q8IUR5-1) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-108: Missing.

Show »
Length:774
Mass (Da):87,338
Checksum:i581E5B9CF1EECDC1
GO
Isoform 2 (identifier: Q8IUR5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-237: Missing.
     238-312: SNKQDKSSNG...VSPRAVWSMM → MTKQDSASKK...PASFSPYILT

Note: No experimental confirmation available.

Show »
Length:645
Mass (Da):73,982
Checksum:i7921799C6F773F78
GO
Isoform 3 (identifier: Q8IUR5-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-108: Missing.
     312-312: M → MRYLRASSNRNFLLTMRPFLKRAILVLSYVLVILYFRLWIMGGSMPLFSEQDNPASFSPYILT
     596-620: ERFKEAEEIYQTGIKNCPDSSDLHN → VIVSHSSFFQCYCYMYKLMLHRFLY
     621-882: Missing.

Note: No experimental confirmation available.

Show »
Length:574
Mass (Da):65,021
Checksum:i53A7A270B3437DB9
GO
Isoform 4 (identifier: Q8IUR5-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-652: Missing.
     672-675: WYKR → C

Note: No experimental confirmation available.

Show »
Length:227
Mass (Da):25,859
Checksum:i3357413F194C2B78
GO

Sequence cautioni

The sequence AAK32121.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti814 – 8141V → L.1 Publication
Corresponds to variant rs17854190 [ dbSNP | Ensembl ].
VAR_031112

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 652652Missing in isoform 4.
VSP_023611Add
BLAST
Alternative sequencei1 – 237237Missing in isoform 2.
VSP_023612Add
BLAST
Alternative sequencei1 – 108108Missing in isoform 1 and isoform 3.
VSP_041823Add
BLAST
Alternative sequencei238 – 31275SNKQD…VWSMM → MTKQDSASKKKKKRYLRASS NRNFLLTMRPFLKRAILVLS YVLVILYFRLWIMGGSMPLF SEQDNPASFSPYILT in isoform 2.
VSP_023613Add
BLAST
Alternative sequencei312 – 3121M → MRYLRASSNRNFLLTMRPFL KRAILVLSYVLVILYFRLWI MGGSMPLFSEQDNPASFSPY ILT in isoform 3.
VSP_023614
Alternative sequencei596 – 62025ERFKE…SDLHN → VIVSHSSFFQCYCYMYKLML HRFLY in isoform 3.
VSP_023615Add
BLAST
Alternative sequencei621 – 882262Missing in isoform 3.
VSP_023616Add
BLAST
Alternative sequencei672 – 6754WYKR → C in isoform 4.
VSP_023617

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
GQ865601 mRNA. Translation: ACX30004.1.
AK055962 mRNA. Translation: BAB71057.1.
AK127297 mRNA. Translation: BAC86923.1.
AC009320 Genomic DNA. No translation available.
AC009510 Genomic DNA. No translation available.
AC012151 Genomic DNA. No translation available.
AC022078 Genomic DNA. No translation available.
BC028716 mRNA. Translation: AAH28716.1.
BC042083 mRNA. Translation: AAH42083.1.
AF319520 mRNA. Translation: AAK32121.1. Different initiation.
CCDSiCCDS53772.1. [Q8IUR5-5]
CCDS8718.1. [Q8IUR5-1]
RefSeqiNP_001180380.1. NM_001193451.1. [Q8IUR5-5]
NP_787057.2. NM_175861.3. [Q8IUR5-1]
UniGeneiHs.401954.

Genome annotation databases

EnsembliENST00000256062; ENSP00000256062; ENSG00000133687. [Q8IUR5-1]
ENST00000381224; ENSP00000370622; ENSG00000133687. [Q8IUR5-3]
ENST00000539277; ENSP00000442046; ENSG00000133687. [Q8IUR5-5]
GeneIDi83857.
KEGGihsa:83857.
UCSCiuc001riy.3. human. [Q8IUR5-4]
uc001riz.3. human. [Q8IUR5-5]
uc001rja.3. human. [Q8IUR5-2]
uc001rjc.1. human. [Q8IUR5-3]

Polymorphism databases

DMDMi347595775.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
GQ865601 mRNA. Translation: ACX30004.1 .
AK055962 mRNA. Translation: BAB71057.1 .
AK127297 mRNA. Translation: BAC86923.1 .
AC009320 Genomic DNA. No translation available.
AC009510 Genomic DNA. No translation available.
AC012151 Genomic DNA. No translation available.
AC022078 Genomic DNA. No translation available.
BC028716 mRNA. Translation: AAH28716.1 .
BC042083 mRNA. Translation: AAH42083.1 .
AF319520 mRNA. Translation: AAK32121.1 . Different initiation.
CCDSi CCDS53772.1. [Q8IUR5-5 ]
CCDS8718.1. [Q8IUR5-1 ]
RefSeqi NP_001180380.1. NM_001193451.1. [Q8IUR5-5 ]
NP_787057.2. NM_175861.3. [Q8IUR5-1 ]
UniGenei Hs.401954.

3D structure databases

ProteinModelPortali Q8IUR5.
SMRi Q8IUR5. Positions 461-856.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q8IUR5. 2 interactions.
MINTi MINT-8383569.
STRINGi 9606.ENSP00000256062.

PTM databases

PhosphoSitei Q8IUR5.

Polymorphism databases

DMDMi 347595775.

Proteomic databases

PaxDbi Q8IUR5.
PRIDEi Q8IUR5.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000256062 ; ENSP00000256062 ; ENSG00000133687 . [Q8IUR5-1 ]
ENST00000381224 ; ENSP00000370622 ; ENSG00000133687 . [Q8IUR5-3 ]
ENST00000539277 ; ENSP00000442046 ; ENSG00000133687 . [Q8IUR5-5 ]
GeneIDi 83857.
KEGGi hsa:83857.
UCSCi uc001riy.3. human. [Q8IUR5-4 ]
uc001riz.3. human. [Q8IUR5-5 ]
uc001rja.3. human. [Q8IUR5-2 ]
uc001rjc.1. human. [Q8IUR5-3 ]

Organism-specific databases

CTDi 83857.
GeneCardsi GC12M029653.
HGNCi HGNC:24099. TMTC1.
HPAi HPA016720.
neXtProti NX_Q8IUR5.
PharmGKBi PA142670718.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0457.
HOVERGENi HBG106148.
InParanoidi Q8IUR5.
OrthoDBi EOG72RMXM.
PhylomeDBi Q8IUR5.
TreeFami TF328339.

Miscellaneous databases

ChiTaRSi TMTC1. human.
GenomeRNAii 83857.
NextBioi 72853.
PROi Q8IUR5.

Gene expression databases

ArrayExpressi Q8IUR5.
Bgeei Q8IUR5.
CleanExi HS_TMTC1.
Genevestigatori Q8IUR5.

Family and domain databases

Gene3Di 1.25.40.10. 4 hits.
InterProi IPR013618. DUF1736.
IPR013026. TPR-contain_dom.
IPR011990. TPR-like_helical.
IPR001440. TPR_1.
IPR019734. TPR_repeat.
[Graphical view ]
Pfami PF08409. DUF1736. 1 hit.
PF00515. TPR_1. 3 hits.
[Graphical view ]
SMARTi SM00028. TPR. 10 hits.
[Graphical view ]
PROSITEi PS50005. TPR. 10 hits.
PS50293. TPR_REGION. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "TMTC1A: A novel member of TPR motif family, as a potential chaperone of HSP70 and HSP90."
    Shen M.Q., Gu W.J., Fu H.L., Li J.M.
    Submitted (SEP-2009) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5).
    Tissue: Mammary gland.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Hippocampus.
  3. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANT LEU-814.
    Tissue: Pancreas and Testis.
  5. "Gene cloning of human adenocarcinoma cell line."
    Yanqiu Z., Huazhang A., Fei L., Yongquan S., Xin W., Taidong Q., Baojun C., Kaichun W., Jie D., Daiming F.
    Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 704-882 (ISOFORMS 1/2/4/5).
    Tissue: Stomach cancer.
  6. "Characterizing the neurite outgrowth inhibitory effect of Mani."
    Mishra M., Lee S., Lin M.K., Yamashita T., Heese K.
    FEBS Lett. 586:3018-3023(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH FAM168B.

Entry informationi

Entry nameiTMTC1_HUMAN
AccessioniPrimary (citable) accession number: Q8IUR5
Secondary accession number(s): D0EP37
, F5H8B5, Q6PIU4, Q6ZSM5, Q96N52, Q9BXM2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: September 21, 2011
Last modified: July 9, 2014
This is version 105 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi