Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8IUR5

- TMTC1_HUMAN

UniProt

Q8IUR5 - TMTC1_HUMAN

Protein

Transmembrane and TPR repeat-containing protein 1

Gene

TMTC1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 106 (01 Oct 2014)
      Sequence version 3 (21 Sep 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Transmembrane and TPR repeat-containing protein 1
    Gene namesi
    Name:TMTC1
    ORF Names:ARG99
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:24099. TMTC1.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. mitochondrion Source: Ensembl

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142670718.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 882882Transmembrane and TPR repeat-containing protein 1PRO_0000280288Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi184 – 1841N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PaxDbiQ8IUR5.
    PRIDEiQ8IUR5.

    PTM databases

    PhosphoSiteiQ8IUR5.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8IUR5.
    BgeeiQ8IUR5.
    CleanExiHS_TMTC1.
    GenevestigatoriQ8IUR5.

    Organism-specific databases

    HPAiHPA016720.

    Interactioni

    Subunit structurei

    May interact with FAM168B.

    Protein-protein interaction databases

    IntActiQ8IUR5. 2 interactions.
    MINTiMINT-8383569.
    STRINGi9606.ENSP00000256062.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8IUR5.
    SMRiQ8IUR5. Positions 461-856.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei21 – 4121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei111 – 13121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei161 – 18121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei198 – 21821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei314 – 33421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei355 – 37521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei382 – 40221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei404 – 42421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei439 – 45921HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati483 – 51634TPR 1Add
    BLAST
    Repeati518 – 54730TPR 2Add
    BLAST
    Repeati548 – 58134TPR 3Add
    BLAST
    Repeati583 – 61533TPR 4Add
    BLAST
    Repeati616 – 64934TPR 5Add
    BLAST
    Repeati650 – 68334TPR 6Add
    BLAST
    Repeati684 – 71633TPR 7Add
    BLAST
    Repeati751 – 78434TPR 8Add
    BLAST
    Repeati789 – 82234TPR 9Add
    BLAST
    Repeati823 – 85634TPR 10Add
    BLAST

    Sequence similaritiesi

    Belongs to the TMTC family.Curated
    Contains 10 TPR repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, TPR repeat, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0457.
    HOVERGENiHBG106148.
    InParanoidiQ8IUR5.
    OrthoDBiEOG72RMXM.
    PhylomeDBiQ8IUR5.
    TreeFamiTF328339.

    Family and domain databases

    Gene3Di1.25.40.10. 4 hits.
    InterProiIPR013618. DUF1736.
    IPR013026. TPR-contain_dom.
    IPR011990. TPR-like_helical.
    IPR001440. TPR_1.
    IPR019734. TPR_repeat.
    [Graphical view]
    PfamiPF08409. DUF1736. 1 hit.
    PF00515. TPR_1. 3 hits.
    [Graphical view]
    SMARTiSM00028. TPR. 10 hits.
    [Graphical view]
    PROSITEiPS50005. TPR. 10 hits.
    PS50293. TPR_REGION. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 5 (identifier: Q8IUR5-5) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVVTTSARGG GGDRTPSRRR GCGLAPAGAA ALLAGASCLC YGRSLQGEFV    50
    HDDVWAIVNN PDVRPGAPLR WGIFTNDFWG KGMAENTSHK SYRPLCVLTF 100
    KLNIFLTGMN PFYFHAVNII LHCLVTLVLM YTCDKTVFKN RGLAFVTALL 150
    FAVHPIHTEA VAGIVGRADV LACLLFLLAF LSYNRSLDQG CVGGSFPSTV 200
    SPFFLLLSLF LGTCAMLVKE TGITVFGVCL VYDLFSLSNK QDKSSNGALC 250
    PRSPQQPGSP QPSSLPGHPH RENGKQQRFP HKGAWGGCHS PLPPEPKSSG 300
    FPVSPRAVWS MMRFLTYSYL LAFNVWLLLA PVTLCYDWQV GSIPLVETIW 350
    DMRNLATIFL AVVMALLSLH CLAAFKRLEH KEVLVGLLFL VFPFIPASNL 400
    FFRVGFVVAE RVLYMPSMGY CILFVHGLSK LCTWLNRCGA TTLIVSTVLL 450
    LLLFSWKTVK QNEIWLSRES LFRSGVQTLP HNAKVHYNYA NFLKDQGRNK 500
    EAIYHYRTAL KLYPRHASAL NNLGTLTRDT AEAKMYYQRA LQLHPQHNRA 550
    LFNLGNLLKS QEKKEEAITL LKDSIKYGPE FADAYSSLAS LLAEQERFKE 600
    AEEIYQTGIK NCPDSSDLHN NYGVFLVDTG LPEKAVAHYQ QAIKLSPSHH 650
    VAMVNLGRLY RSLGENSMAE EWYKRALQVA HKAEILSPLG ALYYNTGRYE 700
    EALQIYQEAA ALQPSQRELR LALAQVLAVM GQTKEAEKMT NHIVSEETGC 750
    LECYRLLSAI YSKQENHDKA LDAIDKALQL KPKDPKVISE LFFTKGNQLR 800
    EQNLLDKAFE SYRVAVQLNP DQAQAWMNMG GIQHIKGKYV SARAYYERAL 850
    QLVPDSKLLK ENLAKLDRLE KRLQEVREKD QT 882
    Length:882
    Mass (Da):98,847
    Last modified:September 21, 2011 - v3
    Checksum:i5E4E0B1453C8AAC0
    GO
    Isoform 1 (identifier: Q8IUR5-1) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-108: Missing.

    Show »
    Length:774
    Mass (Da):87,338
    Checksum:i581E5B9CF1EECDC1
    GO
    Isoform 2 (identifier: Q8IUR5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-237: Missing.
         238-312: SNKQDKSSNG...VSPRAVWSMM → MTKQDSASKK...PASFSPYILT

    Note: No experimental confirmation available.

    Show »
    Length:645
    Mass (Da):73,982
    Checksum:i7921799C6F773F78
    GO
    Isoform 3 (identifier: Q8IUR5-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-108: Missing.
         312-312: M → MRYLRASSNRNFLLTMRPFLKRAILVLSYVLVILYFRLWIMGGSMPLFSEQDNPASFSPYILT
         596-620: ERFKEAEEIYQTGIKNCPDSSDLHN → VIVSHSSFFQCYCYMYKLMLHRFLY
         621-882: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:574
    Mass (Da):65,021
    Checksum:i53A7A270B3437DB9
    GO
    Isoform 4 (identifier: Q8IUR5-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-652: Missing.
         672-675: WYKR → C

    Note: No experimental confirmation available.

    Show »
    Length:227
    Mass (Da):25,859
    Checksum:i3357413F194C2B78
    GO

    Sequence cautioni

    The sequence AAK32121.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti814 – 8141V → L.1 Publication
    Corresponds to variant rs17854190 [ dbSNP | Ensembl ].
    VAR_031112

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 652652Missing in isoform 4. 1 PublicationVSP_023611Add
    BLAST
    Alternative sequencei1 – 237237Missing in isoform 2. 1 PublicationVSP_023612Add
    BLAST
    Alternative sequencei1 – 108108Missing in isoform 1 and isoform 3. 2 PublicationsVSP_041823Add
    BLAST
    Alternative sequencei238 – 31275SNKQD…VWSMM → MTKQDSASKKKKKRYLRASS NRNFLLTMRPFLKRAILVLS YVLVILYFRLWIMGGSMPLF SEQDNPASFSPYILT in isoform 2. 1 PublicationVSP_023613Add
    BLAST
    Alternative sequencei312 – 3121M → MRYLRASSNRNFLLTMRPFL KRAILVLSYVLVILYFRLWI MGGSMPLFSEQDNPASFSPY ILT in isoform 3. 1 PublicationVSP_023614
    Alternative sequencei596 – 62025ERFKE…SDLHN → VIVSHSSFFQCYCYMYKLML HRFLY in isoform 3. 1 PublicationVSP_023615Add
    BLAST
    Alternative sequencei621 – 882262Missing in isoform 3. 1 PublicationVSP_023616Add
    BLAST
    Alternative sequencei672 – 6754WYKR → C in isoform 4. 1 PublicationVSP_023617

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    GQ865601 mRNA. Translation: ACX30004.1.
    AK055962 mRNA. Translation: BAB71057.1.
    AK127297 mRNA. Translation: BAC86923.1.
    AC009320 Genomic DNA. No translation available.
    AC009510 Genomic DNA. No translation available.
    AC012151 Genomic DNA. No translation available.
    AC022078 Genomic DNA. No translation available.
    BC028716 mRNA. Translation: AAH28716.1.
    BC042083 mRNA. Translation: AAH42083.1.
    AF319520 mRNA. Translation: AAK32121.1. Different initiation.
    CCDSiCCDS53772.1. [Q8IUR5-5]
    CCDS8718.1. [Q8IUR5-1]
    RefSeqiNP_001180380.1. NM_001193451.1. [Q8IUR5-5]
    NP_787057.2. NM_175861.3. [Q8IUR5-1]
    UniGeneiHs.401954.

    Genome annotation databases

    EnsembliENST00000256062; ENSP00000256062; ENSG00000133687. [Q8IUR5-1]
    ENST00000539277; ENSP00000442046; ENSG00000133687. [Q8IUR5-5]
    GeneIDi83857.
    KEGGihsa:83857.
    UCSCiuc001riy.3. human. [Q8IUR5-4]
    uc001riz.3. human. [Q8IUR5-5]
    uc001rja.3. human. [Q8IUR5-2]
    uc001rjc.1. human. [Q8IUR5-3]

    Polymorphism databases

    DMDMi347595775.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    GQ865601 mRNA. Translation: ACX30004.1 .
    AK055962 mRNA. Translation: BAB71057.1 .
    AK127297 mRNA. Translation: BAC86923.1 .
    AC009320 Genomic DNA. No translation available.
    AC009510 Genomic DNA. No translation available.
    AC012151 Genomic DNA. No translation available.
    AC022078 Genomic DNA. No translation available.
    BC028716 mRNA. Translation: AAH28716.1 .
    BC042083 mRNA. Translation: AAH42083.1 .
    AF319520 mRNA. Translation: AAK32121.1 . Different initiation.
    CCDSi CCDS53772.1. [Q8IUR5-5 ]
    CCDS8718.1. [Q8IUR5-1 ]
    RefSeqi NP_001180380.1. NM_001193451.1. [Q8IUR5-5 ]
    NP_787057.2. NM_175861.3. [Q8IUR5-1 ]
    UniGenei Hs.401954.

    3D structure databases

    ProteinModelPortali Q8IUR5.
    SMRi Q8IUR5. Positions 461-856.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q8IUR5. 2 interactions.
    MINTi MINT-8383569.
    STRINGi 9606.ENSP00000256062.

    PTM databases

    PhosphoSitei Q8IUR5.

    Polymorphism databases

    DMDMi 347595775.

    Proteomic databases

    PaxDbi Q8IUR5.
    PRIDEi Q8IUR5.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000256062 ; ENSP00000256062 ; ENSG00000133687 . [Q8IUR5-1 ]
    ENST00000539277 ; ENSP00000442046 ; ENSG00000133687 . [Q8IUR5-5 ]
    GeneIDi 83857.
    KEGGi hsa:83857.
    UCSCi uc001riy.3. human. [Q8IUR5-4 ]
    uc001riz.3. human. [Q8IUR5-5 ]
    uc001rja.3. human. [Q8IUR5-2 ]
    uc001rjc.1. human. [Q8IUR5-3 ]

    Organism-specific databases

    CTDi 83857.
    GeneCardsi GC12M029653.
    HGNCi HGNC:24099. TMTC1.
    HPAi HPA016720.
    neXtProti NX_Q8IUR5.
    PharmGKBi PA142670718.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0457.
    HOVERGENi HBG106148.
    InParanoidi Q8IUR5.
    OrthoDBi EOG72RMXM.
    PhylomeDBi Q8IUR5.
    TreeFami TF328339.

    Miscellaneous databases

    ChiTaRSi TMTC1. human.
    GenomeRNAii 83857.
    NextBioi 72853.
    PROi Q8IUR5.

    Gene expression databases

    ArrayExpressi Q8IUR5.
    Bgeei Q8IUR5.
    CleanExi HS_TMTC1.
    Genevestigatori Q8IUR5.

    Family and domain databases

    Gene3Di 1.25.40.10. 4 hits.
    InterProi IPR013618. DUF1736.
    IPR013026. TPR-contain_dom.
    IPR011990. TPR-like_helical.
    IPR001440. TPR_1.
    IPR019734. TPR_repeat.
    [Graphical view ]
    Pfami PF08409. DUF1736. 1 hit.
    PF00515. TPR_1. 3 hits.
    [Graphical view ]
    SMARTi SM00028. TPR. 10 hits.
    [Graphical view ]
    PROSITEi PS50005. TPR. 10 hits.
    PS50293. TPR_REGION. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "TMTC1A: A novel member of TPR motif family, as a potential chaperone of HSP70 and HSP90."
      Shen M.Q., Gu W.J., Fu H.L., Li J.M.
      Submitted (SEP-2009) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5).
      Tissue: Mammary gland.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
      Tissue: Hippocampus.
    3. "The finished DNA sequence of human chromosome 12."
      Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
      , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
      Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANT LEU-814.
      Tissue: Pancreas and Testis.
    5. "Gene cloning of human adenocarcinoma cell line."
      Yanqiu Z., Huazhang A., Fei L., Yongquan S., Xin W., Taidong Q., Baojun C., Kaichun W., Jie D., Daiming F.
      Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 704-882 (ISOFORMS 1/2/4/5).
      Tissue: Stomach cancer.
    6. "Characterizing the neurite outgrowth inhibitory effect of Mani."
      Mishra M., Lee S., Lin M.K., Yamashita T., Heese K.
      FEBS Lett. 586:3018-3023(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH FAM168B.

    Entry informationi

    Entry nameiTMTC1_HUMAN
    AccessioniPrimary (citable) accession number: Q8IUR5
    Secondary accession number(s): D0EP37
    , F5H8B5, Q6PIU4, Q6ZSM5, Q96N52, Q9BXM2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 20, 2007
    Last sequence update: September 21, 2011
    Last modified: October 1, 2014
    This is version 106 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3