Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8IUR5

- TMTC1_HUMAN

UniProt

Q8IUR5 - TMTC1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Transmembrane and TPR repeat-containing protein 1

Gene

TMTC1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Transmembrane and TPR repeat-containing protein 1
Gene namesi
Name:TMTC1
ORF Names:ARG99
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:24099. TMTC1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei21 – 4121HelicalSequence AnalysisAdd
BLAST
Transmembranei111 – 13121HelicalSequence AnalysisAdd
BLAST
Transmembranei161 – 18121HelicalSequence AnalysisAdd
BLAST
Transmembranei198 – 21821HelicalSequence AnalysisAdd
BLAST
Transmembranei314 – 33421HelicalSequence AnalysisAdd
BLAST
Transmembranei355 – 37521HelicalSequence AnalysisAdd
BLAST
Transmembranei382 – 40221HelicalSequence AnalysisAdd
BLAST
Transmembranei404 – 42421HelicalSequence AnalysisAdd
BLAST
Transmembranei439 – 45921HelicalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. mitochondrion Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142670718.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 882882Transmembrane and TPR repeat-containing protein 1PRO_0000280288Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi184 – 1841N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ8IUR5.
PaxDbiQ8IUR5.
PRIDEiQ8IUR5.

PTM databases

PhosphoSiteiQ8IUR5.

Expressioni

Gene expression databases

BgeeiQ8IUR5.
CleanExiHS_TMTC1.
ExpressionAtlasiQ8IUR5. baseline and differential.
GenevestigatoriQ8IUR5.

Organism-specific databases

HPAiHPA016720.

Interactioni

Subunit structurei

May interact with FAM168B.

Protein-protein interaction databases

IntActiQ8IUR5. 2 interactions.
MINTiMINT-8383569.
STRINGi9606.ENSP00000256062.

Structurei

3D structure databases

ProteinModelPortaliQ8IUR5.
SMRiQ8IUR5. Positions 461-856.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati483 – 51634TPR 1Add
BLAST
Repeati518 – 54730TPR 2Add
BLAST
Repeati548 – 58134TPR 3Add
BLAST
Repeati583 – 61533TPR 4Add
BLAST
Repeati616 – 64934TPR 5Add
BLAST
Repeati650 – 68334TPR 6Add
BLAST
Repeati684 – 71633TPR 7Add
BLAST
Repeati751 – 78434TPR 8Add
BLAST
Repeati789 – 82234TPR 9Add
BLAST
Repeati823 – 85634TPR 10Add
BLAST

Sequence similaritiesi

Belongs to the TMTC family.Curated
Contains 10 TPR repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, TPR repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0457.
GeneTreeiENSGT00550000074327.
HOVERGENiHBG106148.
InParanoidiQ8IUR5.
OrthoDBiEOG72RMXM.
PhylomeDBiQ8IUR5.
TreeFamiTF328339.

Family and domain databases

Gene3Di1.25.40.10. 4 hits.
InterProiIPR013618. DUF1736.
IPR013026. TPR-contain_dom.
IPR011990. TPR-like_helical_dom.
IPR001440. TPR_1.
IPR019734. TPR_repeat.
[Graphical view]
PfamiPF08409. DUF1736. 1 hit.
PF00515. TPR_1. 3 hits.
[Graphical view]
SMARTiSM00028. TPR. 10 hits.
[Graphical view]
PROSITEiPS50005. TPR. 10 hits.
PS50293. TPR_REGION. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 5 (identifier: Q8IUR5-5) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVVTTSARGG GGDRTPSRRR GCGLAPAGAA ALLAGASCLC YGRSLQGEFV
60 70 80 90 100
HDDVWAIVNN PDVRPGAPLR WGIFTNDFWG KGMAENTSHK SYRPLCVLTF
110 120 130 140 150
KLNIFLTGMN PFYFHAVNII LHCLVTLVLM YTCDKTVFKN RGLAFVTALL
160 170 180 190 200
FAVHPIHTEA VAGIVGRADV LACLLFLLAF LSYNRSLDQG CVGGSFPSTV
210 220 230 240 250
SPFFLLLSLF LGTCAMLVKE TGITVFGVCL VYDLFSLSNK QDKSSNGALC
260 270 280 290 300
PRSPQQPGSP QPSSLPGHPH RENGKQQRFP HKGAWGGCHS PLPPEPKSSG
310 320 330 340 350
FPVSPRAVWS MMRFLTYSYL LAFNVWLLLA PVTLCYDWQV GSIPLVETIW
360 370 380 390 400
DMRNLATIFL AVVMALLSLH CLAAFKRLEH KEVLVGLLFL VFPFIPASNL
410 420 430 440 450
FFRVGFVVAE RVLYMPSMGY CILFVHGLSK LCTWLNRCGA TTLIVSTVLL
460 470 480 490 500
LLLFSWKTVK QNEIWLSRES LFRSGVQTLP HNAKVHYNYA NFLKDQGRNK
510 520 530 540 550
EAIYHYRTAL KLYPRHASAL NNLGTLTRDT AEAKMYYQRA LQLHPQHNRA
560 570 580 590 600
LFNLGNLLKS QEKKEEAITL LKDSIKYGPE FADAYSSLAS LLAEQERFKE
610 620 630 640 650
AEEIYQTGIK NCPDSSDLHN NYGVFLVDTG LPEKAVAHYQ QAIKLSPSHH
660 670 680 690 700
VAMVNLGRLY RSLGENSMAE EWYKRALQVA HKAEILSPLG ALYYNTGRYE
710 720 730 740 750
EALQIYQEAA ALQPSQRELR LALAQVLAVM GQTKEAEKMT NHIVSEETGC
760 770 780 790 800
LECYRLLSAI YSKQENHDKA LDAIDKALQL KPKDPKVISE LFFTKGNQLR
810 820 830 840 850
EQNLLDKAFE SYRVAVQLNP DQAQAWMNMG GIQHIKGKYV SARAYYERAL
860 870 880
QLVPDSKLLK ENLAKLDRLE KRLQEVREKD QT
Length:882
Mass (Da):98,847
Last modified:September 21, 2011 - v3
Checksum:i5E4E0B1453C8AAC0
GO
Isoform 1 (identifier: Q8IUR5-1) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-108: Missing.

Show »
Length:774
Mass (Da):87,338
Checksum:i581E5B9CF1EECDC1
GO
Isoform 2 (identifier: Q8IUR5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-237: Missing.
     238-312: SNKQDKSSNG...VSPRAVWSMM → MTKQDSASKK...PASFSPYILT

Note: No experimental confirmation available.

Show »
Length:645
Mass (Da):73,982
Checksum:i7921799C6F773F78
GO
Isoform 3 (identifier: Q8IUR5-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-108: Missing.
     312-312: M → MRYLRASSNRNFLLTMRPFLKRAILVLSYVLVILYFRLWIMGGSMPLFSEQDNPASFSPYILT
     596-620: ERFKEAEEIYQTGIKNCPDSSDLHN → VIVSHSSFFQCYCYMYKLMLHRFLY
     621-882: Missing.

Note: No experimental confirmation available.

Show »
Length:574
Mass (Da):65,021
Checksum:i53A7A270B3437DB9
GO
Isoform 4 (identifier: Q8IUR5-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-652: Missing.
     672-675: WYKR → C

Note: No experimental confirmation available.

Show »
Length:227
Mass (Da):25,859
Checksum:i3357413F194C2B78
GO

Sequence cautioni

The sequence AAK32121.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti814 – 8141V → L.1 Publication
Corresponds to variant rs17854190 [ dbSNP | Ensembl ].
VAR_031112

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 652652Missing in isoform 4. 1 PublicationVSP_023611Add
BLAST
Alternative sequencei1 – 237237Missing in isoform 2. 1 PublicationVSP_023612Add
BLAST
Alternative sequencei1 – 108108Missing in isoform 1 and isoform 3. 2 PublicationsVSP_041823Add
BLAST
Alternative sequencei238 – 31275SNKQD…VWSMM → MTKQDSASKKKKKRYLRASS NRNFLLTMRPFLKRAILVLS YVLVILYFRLWIMGGSMPLF SEQDNPASFSPYILT in isoform 2. 1 PublicationVSP_023613Add
BLAST
Alternative sequencei312 – 3121M → MRYLRASSNRNFLLTMRPFL KRAILVLSYVLVILYFRLWI MGGSMPLFSEQDNPASFSPY ILT in isoform 3. 1 PublicationVSP_023614
Alternative sequencei596 – 62025ERFKE…SDLHN → VIVSHSSFFQCYCYMYKLML HRFLY in isoform 3. 1 PublicationVSP_023615Add
BLAST
Alternative sequencei621 – 882262Missing in isoform 3. 1 PublicationVSP_023616Add
BLAST
Alternative sequencei672 – 6754WYKR → C in isoform 4. 1 PublicationVSP_023617

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
GQ865601 mRNA. Translation: ACX30004.1.
AK055962 mRNA. Translation: BAB71057.1.
AK127297 mRNA. Translation: BAC86923.1.
AC009320 Genomic DNA. No translation available.
AC009510 Genomic DNA. No translation available.
AC012151 Genomic DNA. No translation available.
AC022078 Genomic DNA. No translation available.
BC028716 mRNA. Translation: AAH28716.1.
BC042083 mRNA. Translation: AAH42083.1.
AF319520 mRNA. Translation: AAK32121.1. Different initiation.
CCDSiCCDS53772.1. [Q8IUR5-5]
CCDS8718.1. [Q8IUR5-1]
RefSeqiNP_001180380.1. NM_001193451.1. [Q8IUR5-5]
NP_787057.2. NM_175861.3. [Q8IUR5-1]
UniGeneiHs.401954.

Genome annotation databases

EnsembliENST00000256062; ENSP00000256062; ENSG00000133687. [Q8IUR5-1]
ENST00000539277; ENSP00000442046; ENSG00000133687. [Q8IUR5-5]
GeneIDi83857.
KEGGihsa:83857.
UCSCiuc001riy.3. human. [Q8IUR5-4]
uc001riz.3. human. [Q8IUR5-5]
uc001rja.3. human. [Q8IUR5-2]
uc001rjc.1. human. [Q8IUR5-3]

Polymorphism databases

DMDMi347595775.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
GQ865601 mRNA. Translation: ACX30004.1 .
AK055962 mRNA. Translation: BAB71057.1 .
AK127297 mRNA. Translation: BAC86923.1 .
AC009320 Genomic DNA. No translation available.
AC009510 Genomic DNA. No translation available.
AC012151 Genomic DNA. No translation available.
AC022078 Genomic DNA. No translation available.
BC028716 mRNA. Translation: AAH28716.1 .
BC042083 mRNA. Translation: AAH42083.1 .
AF319520 mRNA. Translation: AAK32121.1 . Different initiation.
CCDSi CCDS53772.1. [Q8IUR5-5 ]
CCDS8718.1. [Q8IUR5-1 ]
RefSeqi NP_001180380.1. NM_001193451.1. [Q8IUR5-5 ]
NP_787057.2. NM_175861.3. [Q8IUR5-1 ]
UniGenei Hs.401954.

3D structure databases

ProteinModelPortali Q8IUR5.
SMRi Q8IUR5. Positions 461-856.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q8IUR5. 2 interactions.
MINTi MINT-8383569.
STRINGi 9606.ENSP00000256062.

PTM databases

PhosphoSitei Q8IUR5.

Polymorphism databases

DMDMi 347595775.

Proteomic databases

MaxQBi Q8IUR5.
PaxDbi Q8IUR5.
PRIDEi Q8IUR5.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000256062 ; ENSP00000256062 ; ENSG00000133687 . [Q8IUR5-1 ]
ENST00000539277 ; ENSP00000442046 ; ENSG00000133687 . [Q8IUR5-5 ]
GeneIDi 83857.
KEGGi hsa:83857.
UCSCi uc001riy.3. human. [Q8IUR5-4 ]
uc001riz.3. human. [Q8IUR5-5 ]
uc001rja.3. human. [Q8IUR5-2 ]
uc001rjc.1. human. [Q8IUR5-3 ]

Organism-specific databases

CTDi 83857.
GeneCardsi GC12M029653.
HGNCi HGNC:24099. TMTC1.
HPAi HPA016720.
neXtProti NX_Q8IUR5.
PharmGKBi PA142670718.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0457.
GeneTreei ENSGT00550000074327.
HOVERGENi HBG106148.
InParanoidi Q8IUR5.
OrthoDBi EOG72RMXM.
PhylomeDBi Q8IUR5.
TreeFami TF328339.

Miscellaneous databases

ChiTaRSi TMTC1. human.
GenomeRNAii 83857.
NextBioi 72853.
PROi Q8IUR5.

Gene expression databases

Bgeei Q8IUR5.
CleanExi HS_TMTC1.
ExpressionAtlasi Q8IUR5. baseline and differential.
Genevestigatori Q8IUR5.

Family and domain databases

Gene3Di 1.25.40.10. 4 hits.
InterProi IPR013618. DUF1736.
IPR013026. TPR-contain_dom.
IPR011990. TPR-like_helical_dom.
IPR001440. TPR_1.
IPR019734. TPR_repeat.
[Graphical view ]
Pfami PF08409. DUF1736. 1 hit.
PF00515. TPR_1. 3 hits.
[Graphical view ]
SMARTi SM00028. TPR. 10 hits.
[Graphical view ]
PROSITEi PS50005. TPR. 10 hits.
PS50293. TPR_REGION. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "TMTC1A: A novel member of TPR motif family, as a potential chaperone of HSP70 and HSP90."
    Shen M.Q., Gu W.J., Fu H.L., Li J.M.
    Submitted (SEP-2009) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5).
    Tissue: Mammary gland.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Hippocampus.
  3. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANT LEU-814.
    Tissue: Pancreas and Testis.
  5. "Gene cloning of human adenocarcinoma cell line."
    Yanqiu Z., Huazhang A., Fei L., Yongquan S., Xin W., Taidong Q., Baojun C., Kaichun W., Jie D., Daiming F.
    Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 704-882 (ISOFORMS 1/2/4/5).
    Tissue: Stomach cancer.
  6. "Characterizing the neurite outgrowth inhibitory effect of Mani."
    Mishra M., Lee S., Lin M.K., Yamashita T., Heese K.
    FEBS Lett. 586:3018-3023(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH FAM168B.

Entry informationi

Entry nameiTMTC1_HUMAN
AccessioniPrimary (citable) accession number: Q8IUR5
Secondary accession number(s): D0EP37
, F5H8B5, Q6PIU4, Q6ZSM5, Q96N52, Q9BXM2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: September 21, 2011
Last modified: October 29, 2014
This is version 107 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3