Q8IUQ4 (SIAH1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 113.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: E3 ubiquitin-protein ligase SIAH1 EC=6.3.2.- Alternative name(s): Seven in absentia homolog 1 Short name=Siah-1 Siah-1a | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 282 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates E3 ubiquitin ligase activity either through direct binding to substrates or by functioning as the essential RING domain subunit of larger E3 complexes. Triggers the ubiquitin-mediated degradation of many substrates, including proteins involved in transcription regulation (ELL2, MYB, POU2AF1, PML and RBBP8), a cell surface receptor (DCC), the cell-surface receptor-type tyrosine kinase FLT3, the cytoplasmic signal transduction molecules (KLF10/TIEG1 and NUMB), an antiapoptotic protein (BAG1), a microtubule motor protein (KIF22), a protein involved in synaptic vesicle function in neurons (SYP), a structural protein (CTNNB1) and SNCAIP. Confers constitutive instability to HIPK2 through proteasomal degradation. It is thereby involved in many cellular processes such as apoptosis, tumor suppression, cell cycle, axon guidance, transcription regulation, spermatogenesis and TNF-alpha signaling. Has some overlapping function with SIAH2. Induces apoptosis in cooperation with PEG3. Upon nitric oxid (NO) generation that follows apoptotic stimulation, interacts with S-nitrosylated GAPDH, mediating the translocation of GAPDH to the nucleus. GAPDH acts as a stabilizer of SIAH1, facilitating the degradation of nuclear proteins. Ref.7 Ref.9 Ref.10 Ref.11 Ref.12 Ref.13 Ref.14 Ref.15 Ref.16 Ref.17 Ref.18 Ref.21 Ref.24 Ref.25 Ref.26 Ref.28 Ref.29 Ref.30 Ref.31 |
| Enzyme regulation | Inhibited by interaction with SNCAIP (isoform 2, but not isoform 1). May be inhibited by interaction with PEG10. Ref.28 |
| Pathway | |
| Subunit structure | Homodimer. Interacts with group 1 glutamate receptors GRM1 and GRM5. Interacts with DAB1, which may inhibit its activity. Interacts with UBE2E2. Interacts with PEG3. Interacts with GAPDH; leading to stabilize SIAH1 By similarity. Component of some large E3 complex composed of UBE2D1, SIAH1, CACYBP/SIP, SKP1, APC and TBL1X. Interacts with UBE2I. Interacts with alpha-tubulin. Interacts with PEG10, which may inhibit its activity. Interacts with KHDRBS3. Interacts with SNCAIP and HIPK2. Ref.7 Ref.8 Ref.10 Ref.12 Ref.19 Ref.22 Ref.23 Ref.25 Ref.26 Ref.28 Ref.31 |
| Subcellular location | Cytoplasm. Nucleus. Note: Predominantly cytoplasmic. Partially nuclear. Ref.2 Ref.7 Ref.8 Ref.9 Ref.14 Ref.18 Ref.25 |
| Tissue specificity | Widely expressed at a low level. Down-regulated in advanced hepatocellular carcinomas. Ref.2 Ref.20 |
| Induction | May be induced by p53/TP53, suggesting that it may be required to modulate p53/TP53 response. The relevance of such activity in vivo is however unclear and may not exist. Ref.28 |
| Domain | The RING-type zinc finger domain is essential for ubiquitin ligase activity. The SBD domain (substrate-binding domain) mediates the homodimerization and the interaction with substrate proteins. It is related to the TRAF family By similarity. |
| Post-translational modification | Phosphorylated on Ser-19 by ATM and ATR. This phosphorylation disrupts SIAH1 interaction with HIPK2, and subsequent proteasomal degradation of HIPK2. Ref.26 |
| Sequence similarities | Belongs to the SINA (Seven in absentia) family. Contains 1 RING-type zinc finger. Contains 1 SIAH-type zinc finger. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ATXN7 | O15265 | 2 | EBI-747107,EBI-708350 | |
| MYD88 | Q99836 | 3 | EBI-747107,EBI-447677 | |
| SEPT4 | O43236-6 | 2 | EBI-747107,EBI-4372019 | |
| Sh3rf1 | Q69ZI1 | 5 | EBI-747107,EBI-957380 | From a different organism. |
| XIAP | P98170 | 3 | EBI-747107,EBI-517127 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8IUQ4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8IUQ4-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MTGKATPPSLYSWRGVLFTCLPAARTRKRKEM | ||||||
| Isoform 3 (identifier: Q8IUQ4-3) Also known as: Siah-1S; The sequence of this isoform differs from the canonical sequence as follows: 193-195: LEK → DLS 196-282: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 282 | 282 | E3 ubiquitin-protein ligase SIAH1 | PRO_0000056163 | ||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||
| Zinc finger | 41 – 76 | 36 | RING-type | |||||||||||||||||||||||||||||||
| Zinc finger | 93 – 153 | 61 | SIAH-type | |||||||||||||||||||||||||||||||
| Region | 90 – 282 | 193 | SBD | |||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||
| Metal binding | 98 | 1 | Zinc 1 By similarity | |||||||||||||||||||||||||||||||
| Metal binding | 105 | 1 | Zinc 1 By similarity | |||||||||||||||||||||||||||||||
| Metal binding | 117 | 1 | Zinc 1 By similarity | |||||||||||||||||||||||||||||||
| Metal binding | 121 | 1 | Zinc 1 By similarity | |||||||||||||||||||||||||||||||
| Metal binding | 128 | 1 | Zinc 2 | |||||||||||||||||||||||||||||||
| Metal binding | 135 | 1 | Zinc 2 | |||||||||||||||||||||||||||||||
| Metal binding | 147 | 1 | Zinc 2 | |||||||||||||||||||||||||||||||
| Metal binding | 152 | 1 | Zinc 2 | |||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||
| Modified residue | 19 | 1 | Phosphoserine; by ATM and ATR Ref.26 | |||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MTGKATPPSLYSWRGVLFTC LPAARTRKRKEM in isoform 2. | VSP_010166 | ||||||||||||||||||||||||||||||
| Alternative sequence | 193 – 195 | 3 | LEK → DLS in isoform 3. | VSP_029210 | ||||||||||||||||||||||||||||||
| Alternative sequence | 196 – 282 | 87 | Missing in isoform 3. | VSP_029211 | ||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||
| Mutagenesis | 19 | 1 | S → A: Impaired ATM mediated phosphorylation, but normal interaction with HIPK2 and HIPK2 subsequent proteasomal degradation. Ref.26 | |||||||||||||||||||||||||||||||
| Mutagenesis | 19 | 1 | S → D: Reduced interaction with HIPK2 and HIPK2 subsequent proteasomal degradation. Ref.26 | |||||||||||||||||||||||||||||||
| Mutagenesis | 40 | 1 | E → R: Loss of function. Ref.9 | |||||||||||||||||||||||||||||||
| Mutagenesis | 41 | 1 | C → S: Loss of function; when associated with S-44. Ref.9 | |||||||||||||||||||||||||||||||
| Mutagenesis | 44 | 1 | C → S: Loss of function. Ref.9 Ref.26 | |||||||||||||||||||||||||||||||
| Mutagenesis | 55 | 1 | C → A: Loss of function; when associated with A-59 and S-72. Ref.9 Ref.25 | |||||||||||||||||||||||||||||||
| Mutagenesis | 55 | 1 | C → S: Loss of function; when associated with Y-59. Ref.9 Ref.25 | |||||||||||||||||||||||||||||||
| Mutagenesis | 59 | 1 | H → A: Loss of function; when associated with A-55 and S-72. Ref.9 Ref.25 | |||||||||||||||||||||||||||||||
| Mutagenesis | 59 | 1 | H → Y: Loss of function. Ref.9 Ref.25 | |||||||||||||||||||||||||||||||
| Mutagenesis | 66 | 1 | R → L: Decreased activity; when associated with T-68. Ref.9 | |||||||||||||||||||||||||||||||
| Mutagenesis | 68 | 1 | K → T: Decreased activity; when associated with L-66. Ref.9 | |||||||||||||||||||||||||||||||
| Mutagenesis | 72 | 1 | C → S: Loss of function; when associated with A-55 and A-59. Ref.25 | |||||||||||||||||||||||||||||||
| Mutagenesis | 76 | 1 | R → E: Decreased activity. Ref.9 | |||||||||||||||||||||||||||||||
| Mutagenesis | 124 | 1 | R → A in D; does not impair its ability to interact with CACYBP and degrade CTNNB1 and PML; when associated with A-214; A-215; A-231 and A-232. | |||||||||||||||||||||||||||||||
| Mutagenesis | 142 | 1 | D → A in E; does not impair its ability to interact with CACYBP and degrade CTNNB1; when associated with A-151. | |||||||||||||||||||||||||||||||
| Mutagenesis | 151 | 1 | Q → A in E; does not impair its ability to interact with CACYBP and degrade CTNNB1; when associated with A-142. | |||||||||||||||||||||||||||||||
| Mutagenesis | 152 | 1 | H → Y: Abolishes ability to degrade DCC. Ref.9 | |||||||||||||||||||||||||||||||
| Mutagenesis | 161 – 162 | 2 | ED → AA in A; does not impair its ability to degrade PML while it abolishes its ability to interact with CACYBP and degrade CTNNB1; when associated with A-226 and A-237. | |||||||||||||||||||||||||||||||
| Mutagenesis | 198 – 200 | 3 | KYD → GDG: Impairs CTNNB1 degradation. Ref.31 | |||||||||||||||||||||||||||||||
| Mutagenesis | 202 | 1 | H → Y: No effect. Ref.9 | |||||||||||||||||||||||||||||||
| Mutagenesis | 211 | 1 | L → R: Abolishes ability to degrade DCC. Ref.9 | |||||||||||||||||||||||||||||||
| Mutagenesis | 214 – 215 | 2 | TR → AA in D; does not impair its ability to interact with CACYBP and degrade CTNNB1 and PML; when associated with A-124; A-231 and A-232. | |||||||||||||||||||||||||||||||
| Mutagenesis | 224 | 1 | R → A in C; does not impair its ability to interact with CACYBP and degrade CTNNB1; when associated with A-233. | |||||||||||||||||||||||||||||||
| Mutagenesis | 226 | 1 | E → A in A; does not impair its ability to degrade PML while it abolishes its ability to interact with CACYBP and degrade CTNNB1; when associated with A-161; A-162 and A-237. | |||||||||||||||||||||||||||||||
| Mutagenesis | 231 – 232 | 2 | RR → AA in D; does not impair its ability to interact with CACYBP and degrade CTNNB1 and PML; when associated with A-124; A-214 and A-215. | |||||||||||||||||||||||||||||||
| Mutagenesis | 233 | 1 | R → A in C; does not impair its ability to interact with CACYBP and degrade CTNNB1; when associated with A-233. | |||||||||||||||||||||||||||||||
| Mutagenesis | 237 | 1 | E → A in A; does not impair its ability to degrade PML while it abolishes its ability to interact with CACYBP and degrade CTNNB1; when associated with A-161; A-162 and A-226. | |||||||||||||||||||||||||||||||
| Mutagenesis | 252 | 1 | M → D or K: Impairs CTNNB1 degradation. Ref.31 | |||||||||||||||||||||||||||||||
| Mutagenesis | 253 | 1 | N → A in B; does not impair its ability to interact with CACYBP and degrade CTNNB1; when associated with A-265. | |||||||||||||||||||||||||||||||
| Mutagenesis | 265 | 1 | Q → A in B; does not impair its ability to interact with CACYBP and degrade CTNNB1; when associated with A-253. | |||||||||||||||||||||||||||||||
| Sequence conflict | 173 | 1 | P → S in CAE46191. Ref.5 | |||||||||||||||||||||||||||||||
| Sequence conflict | 245 | 1 | E → G in CAE46191. Ref.5 | |||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||
| Helix | 144 – 151 | 8 | ||||||||||||||||||||||||||||||||
| Beta strand | 157 – 168 | 12 | ||||||||||||||||||||||||||||||||
| Beta strand | 177 – 184 | 8 | ||||||||||||||||||||||||||||||||
| Beta strand | 187 – 195 | 9 | ||||||||||||||||||||||||||||||||
| Beta strand | 204 – 213 | 10 | ||||||||||||||||||||||||||||||||
| Helix | 215 – 218 | 4 | ||||||||||||||||||||||||||||||||
| Beta strand | 221 – 229 | 9 | ||||||||||||||||||||||||||||||||
| Beta strand | 232 – 238 | 7 | ||||||||||||||||||||||||||||||||
| Turn | 243 – 245 | 3 | ||||||||||||||||||||||||||||||||
| Helix | 248 – 252 | 5 | ||||||||||||||||||||||||||||||||
| Beta strand | 256 – 260 | 5 | ||||||||||||||||||||||||||||||||
| Helix | 261 – 267 | 7 | ||||||||||||||||||||||||||||||||
| Beta strand | 269 – 281 | 13 | ||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Activation of the human homologue of the Drosophila sina gene in apoptosis and tumor suppression." Nemani M., Linares-Cruz G., Bruzzoni-Giovanelli H., Roperch J.-P., Tuynder M., Bougueleret L., Cherif D., Medhioub M., Pasturaud P., Alvaro V., Der Sarkissan H., Cazes L., Le Paslier D., Le Gall I., Israeli D., Dausset J., Sigaux F., Chumakov I. Telerman A.Proc. Natl. Acad. Sci. U.S.A. 93:9039-9042(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Intestinal epithelium. |
| [2] | "Characterization of human homologs of the Drosophila seven in absentia (sina) gene." Hu G., Chung Y.-L., Glover T., Valentine V., Look A.T., Fearon E.R. Genomics 46:103-111(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Fetal brain. |
| [3] | "Lack of somatic mutation in the coding sequence of SIAH1 in tumors hemizygous for this candidate tumor suppressor gene." Medhioub M., Vaury C., Hamelin R., Thomas G. Int. J. Cancer 87:794-797(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | "Siah-1S, a novel splice variant of Siah-1 (seven in absentia homolog), counteracts Siah-1-mediated downregulation of beta-catenin." Mei Y., Xie C., Xie W., Wu Z., Wu M. Oncogene 26:6319-6331(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Retina. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain, Pancreas and Testis. |
| [7] | "Mammalian homologs of seven in absentia regulate DCC via the ubiquitin-proteasome pathway." Hu G., Zhang S., Vidal M., Baer J.L., Xu T., Fearon E.R. Genes Dev. 11:2701-2714(1997) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN DEGRADATION OF DCC, SUBCELLULAR LOCATION, INTERACTION WITH UBE2I. |
| [8] | "p53-inducible human homologue of Drosophila seven in absentia (Siah) inhibits cell growth: suppression by BAG-1." Matsuzawa S., Takayama S., Froesch B.A., Zapata J.M., Reed J.C. EMBO J. 17:2736-2747(1998) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH BAG1, SUBCELLULAR LOCATION. |
| [9] | "Siah-1 N-terminal RING domain is required for proteolysis function, and C-terminal sequences regulate oligomerization and binding to target proteins." Hu G., Fearon E.R. Mol. Cell. Biol. 19:724-732(1999) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF GLU-40; CYS-41; CYS-44; CYS-55; HIS-59; ARG-66; LYS-68; ARG-76; HIS-152; HIS-202 AND LEU-211. |
| [10] | "SIAH-1 interacts with alpha-tubulin and degrades the kinesin Kid by the proteasome pathway during mitosis." Germani A., Bruzzoni-Giovanelli H., Fellous A., Gisselbrecht S., Varin-Blank N., Calvo F. Oncogene 19:5997-6006(2000) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN DEGRADATION OF KIF22, INTERACTION WITH ALPHA-TUBULIN. |
| [11] | "p53 suppresses the c-Myb-induced activation of heat shock transcription factor 3." Tanikawa J., Ichikawa-Iwata E., Kanei-Ishii C., Nakai A., Matsuzawa S., Reed J.C., Ishii S. J. Biol. Chem. 275:15578-15585(2000) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN DEGRADATION OF MYB. |
| [12] | "Siah-1, SIP, and Ebi collaborate in a novel pathway for beta-catenin degradation linked to p53 responses." Matsuzawa S., Reed J.C. Mol. Cell 7:915-926(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN DEGRADATION OF CTNNB1, SUBUNIT OF A COMPLEX WITH UBE2D1; CACYBP; SKP1; APC AND TBL1X. |
| [13] | "Siah-1 mediates a novel beta-catenin degradation pathway linking p53 to the adenomatous polyposis coli protein." Liu J., Stevens J., Rote C.A., Yost H.J., Hu Y., Neufeld K.L., White R.L., Matsunami N. Mol. Cell 7:927-936(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN DEGRADATION OF CTNNB1. |
| [14] | "The RING finger protein Siah-1 regulates the level of the transcriptional coactivator OBF-1." Tiedt R., Bartholdy B.A., Matthias G., Newell J.W., Matthias P. EMBO J. 20:4143-4152(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN DEGRADATION OF POU2AF1, SUBCELLULAR LOCATION. |
| [15] | "Regulation of BOB.1/OBF.1 stability by SIAH." Boehm J., He Y., Greiner A., Staudt L., Wirth T. EMBO J. 20:4153-4162(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN DEGRADATION OF POU2AF1. |
| [16] | "Siah-1 binds and regulates the function of Numb." Susini L., Passer B.J., Amzallag-Elbaz N., Juven-Gershon T., Prieur S., Privat N., Tuynder M., Gendron M.-C., Israeel A., Amson R., Oren M., Telerman A. Proc. Natl. Acad. Sci. U.S.A. 98:15067-15072(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN DEGRADATION OF NUMB. |
| [17] | "Modulation of transforming growth factor beta (TGFbeta)/Smad transcriptional responses through targeted degradation of TGFbeta-inducible early gene-1 by human seven in absentia homologue." Johnsen S.A., Subramaniam M., Monroe D.G., Janknecht R., Spelsberg T.C. J. Biol. Chem. 277:30754-30759(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN DEGRADATION OF KLF10. |
| [18] | "Siah-1 facilitates ubiquitination and degradation of synphilin-1." Nagano Y., Yamashita H., Takahashi T., Kishida S., Nakamura T., Iseki E., Hattori N., Mizuno Y., Kikuchi A., Matsumoto M. J. Biol. Chem. 278:51504-51514(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN DEGRADATION OF SNCAIP, SUBCELLULAR LOCATION. |
| [19] | "Involvement of PEG10 in human hepatocellular carcinogenesis through interaction with SIAH1." Okabe H., Satoh S., Furukawa Y., Kato T., Hasegawa S., Nakajima Y., Yamaoka Y., Nakamura Y. Cancer Res. 63:3043-3048(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PEG10. |
| [20] | "SIAH1 inactivation correlates with tumor progression in hepatocellular carcinomas." Matsuo K., Satoh S., Okabe H., Nomura A., Maeda T., Yamaoka Y., Ikai I. Genes Chromosomes Cancer 36:283-291(2003) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [21] | "SIAH-1 interacts with CtIP and promotes its degradation by the proteasome pathway." Germani A., Prabel A., Mourah S., Podgorniak M.-P., Di Carlo A., Ehrlich R., Gisselbrecht S., Varin-Blank N., Calvo F., Bruzzoni-Giovanelli H. Oncogene 22:8845-8851(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN DEGRADATION OF RBBP8. |
| [22] | "Structural analysis of Siah1 and its interactions with Siah-interacting protein (SIP)." Matsuzawa S., Li C., Ni C.-Z., Takayama S., Reed J.C., Ely K.R. J. Biol. Chem. 278:1837-1840(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CACYBP, MUTANTS A; B; C; D AND E. |
| [23] | "SIAH1 targets the alternative splicing factor T-STAR for degradation by the proteasome." Venables J.P., Dalgliesh C., Paronetto M.P., Skitt L., Thornton J.K., Saunders P.T., Sette C., Jones K.T., Elliott D.J. Hum. Mol. Genet. 13:1525-1534(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH KHDRBS3. |
| [24] | "The coiled-coil domain is the structural determinant for mammalian homologues of Drosophila Sina-mediated degradation of promyelocytic leukemia protein and other tripartite motif proteins by the proteasome." Fanelli M., Fantozzi A., De Luca P., Caprodossi S., Matsuzawa S., Lazar M.A., Pelicci P.G., Minucci S. J. Biol. Chem. 279:5374-5379(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN DEGRADATION OF PML, MUTANTS A AND D. |
| [25] | "Ubiquitylation of synphilin-1 and alpha-synuclein by SIAH and its presence in cellular inclusions and Lewy bodies imply a role in Parkinson's disease." Liani E., Eyal A., Avraham E., Shemer R., Szargel R., Berg D., Bornemann A., Riess O., Ross C.A., Rott R., Engelender S. Proc. Natl. Acad. Sci. U.S.A. 101:5500-5505(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH SNCAIP AND SNCA, MUTAGENESIS OF CYS-55; HIS-59 AND CYS-72. |
| [26] | "Control of HIPK2 stability by ubiquitin ligase Siah-1 and checkpoint kinases ATM and ATR." Winter M., Sombroek D., Dauth I., Moehlenbrink J., Scheuermann K., Crone J., Hofmann T.G. Nat. Cell Biol. 10:812-824(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF SER-19 AND CYS-44, INTERACTION WITH HIPK2, PHOSPHORYLATION AT SER-19 BY ATM AND ATR. |
| [27] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [28] | "Synphilin-1A inhibits seven in absentia homolog (SIAH) and modulates alpha-synuclein monoubiquitylation and inclusion formation." Szargel R., Rott R., Eyal A., Haskin J., Shani V., Balan L., Wolosker H., Engelender S. J. Biol. Chem. 284:11706-11716(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SNCAIP, ENZYME REGULATION, FUNCTION. |
| [29] | "Ubiquitin conjugase UBCH8 targets active FMS-like tyrosine kinase 3 for proteasomal degradation." Buchwald M., Pietschmann K., Muller J.P., Bohmer F.D., Heinzel T., Kramer O.H. Leukemia 24:1412-1421(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN UBIQUITINATION OF FLT3. |
| [30] | "The ubiquitin ligase Siah1 controls ELL2 stability and formation of super elongation complexes to modulate gene transcription." Liu M., Hsu J., Chan C., Li Z., Zhou Q. Mol. Cell 46:325-334(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [31] | "Structural analysis of Siah1-Siah-interacting protein interactions and insights into the assembly of an E3 ligase multiprotein complex." Santelli E., Leone M., Li C., Fukushima T., Preece N.E., Olson A.J., Ely K.R., Reed J.C., Pellecchia M., Liddington R.C., Matsuzawa S. J. Biol. Chem. 280:34278-34287(2005) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 90-282 IN COMPLEX WITH ZINC IONS AND CACYBP, FUNCTION, MUTAGENESIS OF 198-LYS--ASP-200 AND MET-252, INTERACTION WITH CACYBP. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U63295 mRNA. Translation: AAC12950.1. U76247 mRNA. Translation: AAC51907.1. AJ400626 Genomic DNA. Translation: CAC35542.1. EF026094 mRNA. Translation: ABK15529.1. BX647064 mRNA. Translation: CAE46191.1. BC035562 mRNA. Translation: AAH35562.1. BC042550 mRNA. Translation: AAH42550.1. BC044920 mRNA. Translation: AAH44920.1. | ||||||||||||
| IPI | IPI00328242. IPI00396517. IPI00872574. | ||||||||||||
| RefSeq | NP_001006611.1. NM_001006610.1. NP_003022.3. NM_003031.3. | ||||||||||||
| UniGene | Hs.706828. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q8IUQ4. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q8IUQ4. 30 interactions. | ||||||||||||
| MINT | MINT-156060. | ||||||||||||
| STRING | 9606.ENSP00000349156. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q8IUQ4. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 46577493. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q8IUQ4. | ||||||||||||
| PRIDE | Q8IUQ4. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 6477. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000356721; ENSP00000349156; ENSG00000196470. ENST00000380006; ENSP00000369343; ENSG00000196470. ENST00000394725; ENSP00000378214; ENSG00000196470. ENST00000568007; ENSP00000456421; ENSG00000196470. | ||||||||||||
| GeneID | 6477. | ||||||||||||
| KEGG | hsa:6477. | ||||||||||||
| UCSC | uc002efn.1. human. uc002efo.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 6477. | ||||||||||||
| GeneCards | GC16M048443. | ||||||||||||
| HGNC | HGNC:10857. SIAH1. | ||||||||||||
| HPA | CAB018724. | ||||||||||||
| MIM | 602212. gene. | ||||||||||||
| neXtProt | NX_Q8IUQ4. | ||||||||||||
| PharmGKB | PA35759. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG264215. | ||||||||||||
| HOGENOM | HOG000231487. | ||||||||||||
| HOVERGEN | HBG055701. | ||||||||||||
| KO | K04506. | ||||||||||||
| OMA | HEETCEF. | ||||||||||||
| OrthoDB | EOG4F7NKB. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_111045. Developmental Biology. | ||||||||||||
| UniPathway | UPA00143. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q8IUQ4. | ||||||||||||
| Bgee | Q8IUQ4. | ||||||||||||
| CleanEx | HS_SIAH1. | ||||||||||||
| Genevestigator | Q8IUQ4. | ||||||||||||
| GermOnline | ENSG00000196470. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 3.30.40.10. 1 hit. 3.90.890.10. 1 hit. | ||||||||||||
| InterPro | IPR004162. 7-in-absentia-prot. IPR018121. 7-in-absentia-prot_TRAF-dom. IPR013323. SIAH-type. IPR008974. TRAF-like. IPR001841. Znf_RING. IPR013083. Znf_RING/FYVE/PHD. IPR013010. Znf_SIAH. [Graphical view] | ||||||||||||
| PANTHER | PTHR10315. PTHR10315. 1 hit. | ||||||||||||
| Pfam | PF03145. Sina. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00184. RING. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF49599. Traf_like. 1 hit. | ||||||||||||
| PROSITE | PS00518. ZF_RING_1. False negative. PS50089. ZF_RING_2. 1 hit. PS51081. ZF_SIAH. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | Q8IUQ4. | ||||||||||||
| GenomeRNAi | 6477. | ||||||||||||
| NextBio | 25161. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | SIAH1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8IUQ4 Secondary accession number(s): A0FKF3 Q92880 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
