Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Glucose transporter type 1

Gene

Glut1

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Facilitative glucose transporter.Curated1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei391 – 3911MonosaccharideBy similarity

GO - Molecular functioni

GO - Biological processi

  • adult chitin-containing cuticle pigmentation Source: FlyBase
  • positive regulation of peptide hormone secretion Source: FlyBase
  • sensory perception of pain Source: FlyBase
Complete GO annotation...

Keywords - Biological processi

Sugar transport, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Glucose transporter type 1
Gene namesi
Name:Glut1
ORF Names:CG43946
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome 3L

Organism-specific databases

FlyBaseiFBgn0264574. Glut1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini24 – 6744CytoplasmicSequence analysisAdd
BLAST
Transmembranei68 – 8821Helical; Name=1Sequence analysisAdd
BLAST
Topological domaini89 – 957ExtracellularSequence analysis
Transmembranei96 – 11621Helical; Name=2Sequence analysisAdd
BLAST
Topological domaini117 – 12711CytoplasmicSequence analysisAdd
BLAST
Transmembranei128 – 14821Helical; Name=3Sequence analysisAdd
BLAST
Topological domaini149 – 16214ExtracellularSequence analysisAdd
BLAST
Transmembranei163 – 18321Helical; Name=4Sequence analysisAdd
BLAST
Topological domaini184 – 1863CytoplasmicSequence analysis
Transmembranei187 – 20721Helical; Name=5Sequence analysisAdd
BLAST
Topological domaini208 – 27265ExtracellularSequence analysisAdd
BLAST
Transmembranei273 – 29321Helical; Name=6Sequence analysisAdd
BLAST
Topological domaini294 – 31017CytoplasmicSequence analysisAdd
BLAST
Transmembranei311 – 33121Helical; Name=7Sequence analysisAdd
BLAST
Topological domaini332 – 3398ExtracellularSequence analysis
Transmembranei340 – 36021Helical; Name=8Sequence analysisAdd
BLAST
Topological domaini361 – 37212CytoplasmicSequence analysisAdd
BLAST
Transmembranei373 – 39321Helical; Name=9Sequence analysisAdd
BLAST
Topological domaini394 – 40512ExtracellularSequence analysisAdd
BLAST
Transmembranei406 – 42621Helical; Name=10Sequence analysisAdd
BLAST
Topological domaini427 – 4293CytoplasmicSequence analysis
Transmembranei430 – 45021Helical; Name=11Sequence analysisAdd
BLAST
Topological domaini451 – 53484ExtracellularSequence analysisAdd
BLAST
Transmembranei535 – 55521Helical; Name=12Sequence analysisAdd
BLAST
Topological domaini556 – 1440885CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2323Sequence analysisAdd
BLAST
Chaini24 – 14401417Glucose transporter type 1PRO_0000428674Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi460 – 4601N-linked (GlcNAc...)Sequence analysis
Glycosylationi480 – 4801N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ8IRI6.

Expressioni

Gene expression databases

BgeeiFBgn0264574.
ExpressionAtlasiQ8IRI6. differential.
GenevisibleiQ8IRI6. DM.

Interactioni

Protein-protein interaction databases

BioGridi63662. 2 interactions.
IntActiQ8IRI6. 2 interactions.
MINTiMINT-1021254.
STRINGi7227.FBpp0305685.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni283 – 2897Monosaccharide bindingBy similarity

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi685 – 78399His-richAdd
BLAST
Compositional biasi686 – 75671Gln-richAdd
BLAST
Compositional biasi1148 – 1249102Asn-richAdd
BLAST
Compositional biasi1375 – 140733His-richAdd
BLAST

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0569. Eukaryota.
COG0477. LUCA.
GeneTreeiENSGT00760000119022.
HOGENOMiHOG000030203.
InParanoidiQ8IRI6.
KOiK07299.
OMAiIKEFFGY.
OrthoDBiEOG091G0A9K.

Family and domain databases

CDDicd06174. MFS. 1 hit.
InterProiIPR020846. MFS_dom.
IPR005828. MFS_sugar_transport_like.
IPR003663. Sugar/inositol_transpt.
IPR005829. Sugar_transporter_CS.
[Graphical view]
PfamiPF00083. Sugar_tr. 1 hit.
[Graphical view]
PRINTSiPR00171. SUGRTRNSPORT.
SUPFAMiSSF103473. SSF103473. 2 hits.
TIGRFAMsiTIGR00879. SP. 1 hit.
PROSITEiPS50850. MFS. 1 hit.
PS00217. SUGAR_TRANSPORT_2. 1 hit.
[Graphical view]

Sequences (16)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 16 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform P (identifier: Q8IRI6-5) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAFLCAPGLT FFLTYSIFSA VLGMLQFGYN TGVINAPEKN IENFMKDVYK
60 70 80 90 100
DRYGEDISEE FIQQLYSVAV SIFAIGGMLG GFSGGWMANR FGRKGGLLLN
110 120 130 140 150
NVLGIAGACL MGFTKVSHSY EMLFLGRFII GVNCGLNTSL VPMYISEIAP
160 170 180 190 200
LNLRGGLGTV NQLAVTVGLL LSQVLGIEQI LGTNEGWPIL LGLAICPAIL
210 220 230 240 250
QLILLPVCPE SPRYLLITKQ WEEEARKALR RLRASGSVEE DIEEMRAEER
260 270 280 290 300
AQQSESHIST MELICSPTLR PPLIIGIVMQ LSQQFSGINA VFYYSTSLFM
310 320 330 340 350
SSGLTEESAK FATIGIGAIM VVMTLVSIPL MDRTGRRTLH LYGLGGMFIF
360 370 380 390 400
SIFITISFLI KEMIDWMSYL SVVATLGFVV FFAVGPGSIP WMITAELFSQ
410 420 430 440 450
GPRPSAMAIA VLVNWMANFV VGIGFPSMKT ALENYTFLPF SVFLAIFWIF
460 470 480 490 500
TYKKVPETKN KTFEEILALF RHNNGRSMLN CTNSLEPQSM NSGIEHAALM
510 520 530 540 550
VSEEKTQHDS LFGTTSFSLT VEGMGPYPLS DSTNLLGPGS SSYGPGGVLG
560 570 580 590 600
LAGSGSGLGG QCYTNYGTNL QTPQAARKCH YDEVDDYSFR RHSAHGRITQ
610 620 630 640 650
MKGKPLILGP TIKKDKKKER TDWLTASERF LEGGRSTHQG RSAASAPHHP
660 670 680 690 700
RQPPPVCPSS GPXLRSASPP DSASVRSTSR AEEPHQPQQV HHQQQQVHHQ
710 720 730 740 750
QQHQSRYATH EYVHCSYEKE VVCDQANPSQ APPQQPAPPV QQHQQQPPPP
760 770 780 790 800
LHHCQQRKHS HSPHHSRHTS PHSHHHHSHH SRHSRRSRRQ GSGSLPGAHQ
810 820 830 840 850
GSANHSVMRP SICTSRRHRS VTDISTTNVC QDPACSDREV QEIMVRRTCC
860 870 880 890 900
NTTATNSSSR TELAQCFAED LYGSSRRPSS CCTSSDYCYQ TDSTSLYGSR
910 920 930 940 950
SSLSRNNSIK SASALVRKHH RSQRSLLPEH RHPSYTSISL RGLNASRPNS
960 970 980 990 1000
QLGSLTSIFD RAKNMAPEGS TLERQSSKGA LGSSELPEYA CSPSPIRWSF
1010 1020 1030 1040 1050
LADGRSPSEM EGAVGGGPER EQEEEDKLDA WQVPEPEPEK KPCRKITTSS
1060 1070 1080 1090 1100
SVYDEGPSTS AAAARKRRGS KGSRGSKGSG SYHCEFEDEA TTTVMFHQDA
1110 1120 1130 1140 1150
GEAYNNCCSN NYNYIQCNTY LDQDLQITSE DIHQYLSKGD ATASDILNNS
1160 1170 1180 1190 1200
KNYPFQPSNA LEFQYKNNFQ QGQANANNNN TNTTNTASSD AAECFQNYRA
1210 1220 1230 1240 1250
ISKETNLNQT STEQLSPTNI NLSTSSNNIN IVFSSSLERN ANEVKFINNR
1260 1270 1280 1290 1300
SGASGGSEMG CEVGHHAGYL PYTYPSYDYT NMSGNSHFEK PLGIDELPKE
1310 1320 1330 1340 1350
FCGLEGAGGG GASTTSEHSS SLPSPQPLTH HQQLHHFESF DAASEHNLLA
1360 1370 1380 1390 1400
AQPMSPGSPL SGSVNPAGDD FVQMHHYHHA NSPHSQSHHS HAHTHTHGHH
1410 1420 1430 1440
VHHLLNHPAY DLTDDQFRLG SALKRVRKRA RKYTDFLRKK
Note: No experimental confirmation available.
Length:1,440
Mass (Da):158,555
Last modified:April 16, 2014 - v4
Checksum:i2F25FBC5E83AA97C
GO
Isoform B1 Publication (identifier: Q8IRI6-2) [UniParc]FASTAAdd to basket
Also known as: C1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     477-481: SMLNC → YVSLH
     482-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:481
Mass (Da):53,171
Checksum:i3026AEEE777DB41E
GO
Isoform D (identifier: Q8IRI6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     476-508: RSMLNCTNSLEPQSMNSGIEHAALMVSEEKTQH → SEDNANGNSVTTADFELSQNDGEEKGGVHAKAQ
     509-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:508
Mass (Da):55,817
Checksum:iF25CA8E2BA9223CC
GO
Isoform L (identifier: Q8IRI6-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAFLCAP → MSMNLSAKLD...HRRKLRLLEQ
     362-362: E → EFFGYVQE
     476-508: RSMLNCTNSLEPQSMNSGIEHAALMVSEEKTQH → SEDNANGNSVTTADFELSQNDGEEKGGVHAKAQ
     509-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:602
Mass (Da):67,096
Checksum:iD5F2B65EA765DF01
GO
Isoform S (identifier: Q8IRI6-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAFLCAP → MATIGDLSMI...HRRKLRLLEQ
     362-411: EMIDWMSYLS...PRPSAMAIAV → ASIVVSRILE...FSDLHMTLKS
     412-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:647
Mass (Da):72,191
Checksum:iC05E8E4FE249C2FB
GO
Isoform U (identifier: Q8IRI6-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAFLCAP → MATIGDLSMI...HRRKLRLLEQ
     8-72: GLTFFLTYSI...QQLYSVAVSI → NQLPTTQSQT...TQTNLSPITT
     73-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:308
Mass (Da):35,173
Checksum:iD56CBE3B1AD45AFC
GO
Isoform Q (identifier: Q8IRI6-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     511-625: LFGTTSFSLT...KKKERTDWLT → P

Note: No experimental confirmation available.
Show »
Length:1,326
Mass (Da):146,370
Checksum:iDA49A545476927C3
GO
Isoform M (identifier: Q8IRI6-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     476-478: RSM → SRA
     479-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:478
Mass (Da):52,729
Checksum:iC1682C041E6CE2BA
GO
Isoform J (identifier: Q8IRI6-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     511-625: LFGTTSFSLT...KKKERTDWLT → P
     663-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:548
Mass (Da):60,199
Checksum:i4E44C85D7C91FF81
GO
Isoform O (identifier: Q8IRI6-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-7: P → PVKRDMVAIKHELDTVQQVKEEIEELREYVDRLEEHTHRRKLRLLEQVCSLNYLPCC
     362-362: E → EFFGYVQE
     476-508: RSMLNCTNSLEPQSMNSGIEHAALMVSEEKTQH → SEDNANGNSVTTADFELSQNDGEEKGGVHAKAQ
     509-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:571
Mass (Da):63,506
Checksum:iC6EBA87A5A544E13
GO
Isoform R (identifier: Q8IRI6-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAFLCAP → MATIGDLSMI...QMQMLFGLAS
     362-362: E → EFFGYVQE
     476-508: RSMLNCTNSLEPQSMNSGIEHAALMVSEEKTQH → SEDNANGNSVTTADFELSQNDGEEKGGVHAKAQ
     509-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:802
Mass (Da):89,630
Checksum:i3686233B4CACD72D
GO
Isoform W (identifier: Q8IRI6-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAFLCAP → MATIGDLSMI...HRRKLRLLEQ
     476-508: RSMLNCTNSLEPQSMNSGIEHAALMVSEEKTQH → SEDNANGNSVTTADFELSQNDGEEKGGVHAKAQ
     509-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:744
Mass (Da):83,045
Checksum:i605975D5CFFFC251
GO
Isoform X (identifier: Q8IRI6-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAFLCAP → MATIGDLSMI...HRRKLRLLEQ
     511-625: LFGTTSFSLT...KKKERTDWLT → P
     663-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:784
Mass (Da):87,427
Checksum:iBBFE9FC3379FBFE8
GO
Isoform V (identifier: Q8IRI6-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAFLCAP → MATIGDLSMI...HRRKLRLLEQ
     477-481: SMLNC → YVSLH
     482-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:717
Mass (Da):80,398
Checksum:i3BAF1601C3481C2F
GO
Isoform E (identifier: Q8IRI6-17) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     362-362: E → EFFGYVQE
     477-481: SMLNC → YVSLH
     482-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:488
Mass (Da):54,042
Checksum:iA8C1F942766F1EF1
GO
Isoform T (identifier: Q8IRI6-18) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-149: MAFLCAPGLT...LVPMYISEIA → MATIGDLSMI...LLEFAQVMFS
     150-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:149
Mass (Da):16,880
Checksum:i641B3D1483ACA4AA
GO

Sequence cautioni

The sequence AAL13347 differs from that shown. Reason: Frameshift at position 49. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 149149MAFLC…ISEIA → MATIGDLSMISPPTSSISND QDPFGQLPPLPPPLRSTQVL QPLSVFPVSNLSEDSYDYVF GGRRKTPPTTTSTQLKLTSP PVRLRPEDAYRGANINNGRF YRHSFSYAPKRQRHSSRDDR DRESRLRCHGEDEATLRQLL LEFAQVMFS in isoform T. CuratedVSP_054193Add
BLAST
Alternative sequencei1 – 77MAFLCAP → MSMNLSAKLDELQRGDRHLE TTVALCEIRTQLQELTKSVE SCQSEVSEVKRDMVAIKHEL DTVQQVKEEIEELREYVDRL EEHTHRRKLRLLEQ in isoform L. CuratedVSP_054194
Alternative sequencei1 – 77MAFLCAP → MATIGDLSMISPPTSSISND QDPFGQLPPLPPPLRSTQVL QPLSVFPVSNLSEDSYDYVF GGRRKTPPTTTSTQLKLTSP PVRLRPEDAYRGANINNGRF YRHSFSYAPKRQRHSSRDDR DRESRLRCHGEDEATLRQLL LDLQKQVSVMSMNLSAKLDE LQRGDRHLETTVALCEIRTQ LQELTKSVESCQSEVSEVKR DMVAIKHELDTVQQVKEEIE ELREYVDRLEEHTHRRKLRL LEQNQLPTTQSQTTTRPKNH PELPEHPSTQPHKTTDGRNC HHDGQMQMLFGLAS in isoform R. CuratedVSP_054195
Alternative sequencei1 – 77MAFLCAP → MATIGDLSMISPPTSSISND QDPFGQLPPLPPPLRSTQVL QPLSVFPVSNLSEDSYDYVF GGRRKTPPTTTSTQLKLTSP PVRLRPEDAYRGANINNGRF YRHSFSYAPKRQRHSSRDDR DRESRLRCHGEDEATLRQLL LDLQKQVSVMSMNLSAKLDE LQRGDRHLETTVALCEIRTQ LQELTKSVESCQSEVSEVKR DMVAIKHELDTVQQVKEEIE ELREYVDRLEEHTHRRKLRL LEQ in isoform S, isoform U, isoform W, isoform X and isoform V. 1 PublicationVSP_054196
Alternative sequencei7 – 71P → PVKRDMVAIKHELDTVQQVK EEIEELREYVDRLEEHTHRR KLRLLEQVCSLNYLPCC in isoform O. CuratedVSP_054197
Alternative sequencei8 – 7265GLTFF…VAVSI → NQLPTTQSQTTTRPKNHPEL PEHPSTQPHKTTDGRNCHHD GQMQMLFGLASVSVHTQTNL SPITT in isoform U. CuratedVSP_054198Add
BLAST
Alternative sequencei73 – 14401368Missing in isoform U. CuratedVSP_054199Add
BLAST
Alternative sequencei150 – 14401291Missing in isoform T. CuratedVSP_054200Add
BLAST
Alternative sequencei362 – 41150EMIDW…MAIAV → ASIVVSRILESCSCSCRVMP ANVNAKMPASLGLHLFVPRP FSDLHMTLKS in isoform S. 1 PublicationVSP_054201Add
BLAST
Alternative sequencei362 – 3621E → EFFGYVQE in isoform L, isoform E, isoform O and isoform R. 1 PublicationVSP_054202
Alternative sequencei412 – 14401029Missing in isoform S. 1 PublicationVSP_054203Add
BLAST
Alternative sequencei476 – 50833RSMLN…EKTQH → SEDNANGNSVTTADFELSQN DGEEKGGVHAKAQ in isoform D, isoform L, isoform O, isoform R and isoform W. CuratedVSP_054204Add
BLAST
Alternative sequencei476 – 4783RSM → SRA in isoform M. CuratedVSP_054205
Alternative sequencei477 – 4815SMLNC → YVSLH in isoform B, isoform E and isoform V. 2 PublicationsVSP_054206
Alternative sequencei479 – 1440962Missing in isoform M. CuratedVSP_054207Add
BLAST
Alternative sequencei482 – 1440959Missing in isoform B, isoform E and isoform V. 2 PublicationsVSP_054208Add
BLAST
Alternative sequencei509 – 1440932Missing in isoform D, isoform L, isoform O, isoform R and isoform W. CuratedVSP_054209Add
BLAST
Alternative sequencei511 – 625115LFGTT…TDWLT → P in isoform Q, isoform J and isoform X. CuratedVSP_054210Add
BLAST
Alternative sequencei663 – 1440778Missing in isoform J and isoform X. CuratedVSP_054211Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF064703 mRNA. Translation: AAC36683.2.
AE014296 Genomic DNA. Translation: AAF47434.2.
AE014296 Genomic DNA. Translation: AAN11454.5.
AE014296 Genomic DNA. Translation: ABW08432.1.
AE014296 Genomic DNA. Translation: ABW08433.1.
AE014296 Genomic DNA. Translation: ABW08434.2.
AE014296 Genomic DNA. Translation: ABW08435.2.
AE014296 Genomic DNA. Translation: AGB93925.1.
AE014296 Genomic DNA. Translation: AGB93926.1.
AE014296 Genomic DNA. Translation: AGB93927.1.
AE014296 Genomic DNA. Translation: AGB93928.1.
AE014296 Genomic DNA. Translation: AGB93929.1.
AE014296 Genomic DNA. Translation: AGB93930.1.
AE014296 Genomic DNA. Translation: AGB93931.1.
AE014296 Genomic DNA. Translation: AGB93932.1.
AE014296 Genomic DNA. Translation: AGB93933.1.
AY059441 mRNA. Translation: AAL13347.1. Frameshift.
BT011383 mRNA. Translation: AAR96175.1.
RefSeqiNP_001097467.1. NM_001103997.3. [Q8IRI6-3]
NP_001097468.1. NM_001103998.3. [Q8IRI6-17]
NP_001097469.2. NM_001103999.4. [Q8IRI6-6]
NP_001097470.2. NM_001104000.2. [Q8IRI6-9]
NP_001261230.1. NM_001274301.1. [Q8IRI6-10]
NP_001261231.1. NM_001274302.1. [Q8IRI6-11]
NP_001261232.1. NM_001274303.1. [Q8IRI6-12]
NP_001261233.1. NM_001274304.1. [Q8IRI6-13]
NP_001261234.1. NM_001274305.1. [Q8IRI6-18]
NP_001261235.1. NM_001274306.1. [Q8IRI6-8]
NP_001261236.1. NM_001274307.1. [Q8IRI6-16]
NP_001261237.1. NM_001274308.1. [Q8IRI6-14]
NP_001261238.1. NM_001274309.1. [Q8IRI6-15]
NP_001286896.1. NM_001299967.1. [Q8IRI6-11]
NP_523878.1. NM_079154.3. [Q8IRI6-2]
NP_612073.2. NM_138229.2. [Q8IRI6-5]
NP_728557.1. NM_167845.3. [Q8IRI6-2]
NP_728558.5. NM_167846.3. [Q8IRI6-7]
UniGeneiDm.4347.

Genome annotation databases

EnsemblMetazoaiFBtr0333501; FBpp0305685; FBgn0264574. [Q8IRI6-5]
GeneIDi38109.
KEGGidme:Dmel_CG43946.
UCSCiCG1086-RE. d. melanogaster.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF064703 mRNA. Translation: AAC36683.2.
AE014296 Genomic DNA. Translation: AAF47434.2.
AE014296 Genomic DNA. Translation: AAN11454.5.
AE014296 Genomic DNA. Translation: ABW08432.1.
AE014296 Genomic DNA. Translation: ABW08433.1.
AE014296 Genomic DNA. Translation: ABW08434.2.
AE014296 Genomic DNA. Translation: ABW08435.2.
AE014296 Genomic DNA. Translation: AGB93925.1.
AE014296 Genomic DNA. Translation: AGB93926.1.
AE014296 Genomic DNA. Translation: AGB93927.1.
AE014296 Genomic DNA. Translation: AGB93928.1.
AE014296 Genomic DNA. Translation: AGB93929.1.
AE014296 Genomic DNA. Translation: AGB93930.1.
AE014296 Genomic DNA. Translation: AGB93931.1.
AE014296 Genomic DNA. Translation: AGB93932.1.
AE014296 Genomic DNA. Translation: AGB93933.1.
AY059441 mRNA. Translation: AAL13347.1. Frameshift.
BT011383 mRNA. Translation: AAR96175.1.
RefSeqiNP_001097467.1. NM_001103997.3. [Q8IRI6-3]
NP_001097468.1. NM_001103998.3. [Q8IRI6-17]
NP_001097469.2. NM_001103999.4. [Q8IRI6-6]
NP_001097470.2. NM_001104000.2. [Q8IRI6-9]
NP_001261230.1. NM_001274301.1. [Q8IRI6-10]
NP_001261231.1. NM_001274302.1. [Q8IRI6-11]
NP_001261232.1. NM_001274303.1. [Q8IRI6-12]
NP_001261233.1. NM_001274304.1. [Q8IRI6-13]
NP_001261234.1. NM_001274305.1. [Q8IRI6-18]
NP_001261235.1. NM_001274306.1. [Q8IRI6-8]
NP_001261236.1. NM_001274307.1. [Q8IRI6-16]
NP_001261237.1. NM_001274308.1. [Q8IRI6-14]
NP_001261238.1. NM_001274309.1. [Q8IRI6-15]
NP_001286896.1. NM_001299967.1. [Q8IRI6-11]
NP_523878.1. NM_079154.3. [Q8IRI6-2]
NP_612073.2. NM_138229.2. [Q8IRI6-5]
NP_728557.1. NM_167845.3. [Q8IRI6-2]
NP_728558.5. NM_167846.3. [Q8IRI6-7]
UniGeneiDm.4347.

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi63662. 2 interactions.
IntActiQ8IRI6. 2 interactions.
MINTiMINT-1021254.
STRINGi7227.FBpp0305685.

Proteomic databases

PaxDbiQ8IRI6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0333501; FBpp0305685; FBgn0264574. [Q8IRI6-5]
GeneIDi38109.
KEGGidme:Dmel_CG43946.
UCSCiCG1086-RE. d. melanogaster.

Organism-specific databases

CTDi38109.
FlyBaseiFBgn0264574. Glut1.

Phylogenomic databases

eggNOGiKOG0569. Eukaryota.
COG0477. LUCA.
GeneTreeiENSGT00760000119022.
HOGENOMiHOG000030203.
InParanoidiQ8IRI6.
KOiK07299.
OMAiIKEFFGY.
OrthoDBiEOG091G0A9K.

Miscellaneous databases

ChiTaRSiGlut1. fly.
GenomeRNAii38109.
PROiQ8IRI6.

Gene expression databases

BgeeiFBgn0264574.
ExpressionAtlasiQ8IRI6. differential.
GenevisibleiQ8IRI6. DM.

Family and domain databases

CDDicd06174. MFS. 1 hit.
InterProiIPR020846. MFS_dom.
IPR005828. MFS_sugar_transport_like.
IPR003663. Sugar/inositol_transpt.
IPR005829. Sugar_transporter_CS.
[Graphical view]
PfamiPF00083. Sugar_tr. 1 hit.
[Graphical view]
PRINTSiPR00171. SUGRTRNSPORT.
SUPFAMiSSF103473. SSF103473. 2 hits.
TIGRFAMsiTIGR00879. SP. 1 hit.
PROSITEiPS50850. MFS. 1 hit.
PS00217. SUGAR_TRANSPORT_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiGTR1_DROME
AccessioniPrimary (citable) accession number: Q8IRI6
Secondary accession number(s): A8JNH6
, A8JNH8, A8JNH9, M9PBH4, M9PBH5, M9PDK7, M9PDL1, M9PDS4, M9PDS9, M9PE46, M9PGN5, M9PGP2, O77131, Q0E8K0, Q6NNA9, Q95TE8, Q9V409, Q9W0L2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 12, 2005
Last sequence update: April 16, 2014
Last modified: September 7, 2016
This is version 117 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.