Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Glucose transporter type 1

Gene

Glut1

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Facilitative glucose transporter.Curated1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei391MonosaccharideBy similarity1

GO - Molecular functioni

GO - Biological processi

  • adult chitin-containing cuticle pigmentation Source: FlyBase
  • carbohydrate transport Source: UniProtKB-KW
  • positive regulation of peptide hormone secretion Source: FlyBase
  • sensory perception of pain Source: FlyBase
Complete GO annotation...

Keywords - Biological processi

Sugar transport, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Glucose transporter type 1
Gene namesi
Name:Glut1
ORF Names:CG43946
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome 3L

Organism-specific databases

FlyBaseiFBgn0264574. Glut1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini24 – 67CytoplasmicSequence analysisAdd BLAST44
Transmembranei68 – 88Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini89 – 95ExtracellularSequence analysis7
Transmembranei96 – 116Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini117 – 127CytoplasmicSequence analysisAdd BLAST11
Transmembranei128 – 148Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini149 – 162ExtracellularSequence analysisAdd BLAST14
Transmembranei163 – 183Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini184 – 186CytoplasmicSequence analysis3
Transmembranei187 – 207Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini208 – 272ExtracellularSequence analysisAdd BLAST65
Transmembranei273 – 293Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini294 – 310CytoplasmicSequence analysisAdd BLAST17
Transmembranei311 – 331Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini332 – 339ExtracellularSequence analysis8
Transmembranei340 – 360Helical; Name=8Sequence analysisAdd BLAST21
Topological domaini361 – 372CytoplasmicSequence analysisAdd BLAST12
Transmembranei373 – 393Helical; Name=9Sequence analysisAdd BLAST21
Topological domaini394 – 405ExtracellularSequence analysisAdd BLAST12
Transmembranei406 – 426Helical; Name=10Sequence analysisAdd BLAST21
Topological domaini427 – 429CytoplasmicSequence analysis3
Transmembranei430 – 450Helical; Name=11Sequence analysisAdd BLAST21
Topological domaini451 – 534ExtracellularSequence analysisAdd BLAST84
Transmembranei535 – 555Helical; Name=12Sequence analysisAdd BLAST21
Topological domaini556 – 1440CytoplasmicSequence analysisAdd BLAST885

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 23Sequence analysisAdd BLAST23
ChainiPRO_000042867424 – 1440Glucose transporter type 1Add BLAST1417

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi460N-linked (GlcNAc...)Sequence analysis1
Glycosylationi480N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ8IRI6.
PRIDEiQ8IRI6.

Expressioni

Gene expression databases

BgeeiFBgn0264574.
ExpressionAtlasiQ8IRI6. baseline.
GenevisibleiQ8IRI6. DM.

Interactioni

Protein-protein interaction databases

BioGridi63662. 2 interactors.
IntActiQ8IRI6. 2 interactors.
MINTiMINT-1021254.
STRINGi7227.FBpp0305685.

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni283 – 289Monosaccharide bindingBy similarity7

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi685 – 783His-richAdd BLAST99
Compositional biasi686 – 756Gln-richAdd BLAST71
Compositional biasi1148 – 1249Asn-richAdd BLAST102
Compositional biasi1375 – 1407His-richAdd BLAST33

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0569. Eukaryota.
COG0477. LUCA.
GeneTreeiENSGT00760000119022.
HOGENOMiHOG000030203.
InParanoidiQ8IRI6.
KOiK07299.
OMAiIKEFFGY.
OrthoDBiEOG091G0A9K.

Family and domain databases

CDDicd06174. MFS. 1 hit.
InterProiIPR020846. MFS_dom.
IPR005828. MFS_sugar_transport-like.
IPR003663. Sugar/inositol_transpt.
IPR005829. Sugar_transporter_CS.
[Graphical view]
PfamiPF00083. Sugar_tr. 1 hit.
[Graphical view]
PRINTSiPR00171. SUGRTRNSPORT.
SUPFAMiSSF103473. SSF103473. 2 hits.
TIGRFAMsiTIGR00879. SP. 1 hit.
PROSITEiPS50850. MFS. 1 hit.
PS00217. SUGAR_TRANSPORT_2. 1 hit.
[Graphical view]

Sequences (16)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 16 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform P (identifier: Q8IRI6-5) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAFLCAPGLT FFLTYSIFSA VLGMLQFGYN TGVINAPEKN IENFMKDVYK
60 70 80 90 100
DRYGEDISEE FIQQLYSVAV SIFAIGGMLG GFSGGWMANR FGRKGGLLLN
110 120 130 140 150
NVLGIAGACL MGFTKVSHSY EMLFLGRFII GVNCGLNTSL VPMYISEIAP
160 170 180 190 200
LNLRGGLGTV NQLAVTVGLL LSQVLGIEQI LGTNEGWPIL LGLAICPAIL
210 220 230 240 250
QLILLPVCPE SPRYLLITKQ WEEEARKALR RLRASGSVEE DIEEMRAEER
260 270 280 290 300
AQQSESHIST MELICSPTLR PPLIIGIVMQ LSQQFSGINA VFYYSTSLFM
310 320 330 340 350
SSGLTEESAK FATIGIGAIM VVMTLVSIPL MDRTGRRTLH LYGLGGMFIF
360 370 380 390 400
SIFITISFLI KEMIDWMSYL SVVATLGFVV FFAVGPGSIP WMITAELFSQ
410 420 430 440 450
GPRPSAMAIA VLVNWMANFV VGIGFPSMKT ALENYTFLPF SVFLAIFWIF
460 470 480 490 500
TYKKVPETKN KTFEEILALF RHNNGRSMLN CTNSLEPQSM NSGIEHAALM
510 520 530 540 550
VSEEKTQHDS LFGTTSFSLT VEGMGPYPLS DSTNLLGPGS SSYGPGGVLG
560 570 580 590 600
LAGSGSGLGG QCYTNYGTNL QTPQAARKCH YDEVDDYSFR RHSAHGRITQ
610 620 630 640 650
MKGKPLILGP TIKKDKKKER TDWLTASERF LEGGRSTHQG RSAASAPHHP
660 670 680 690 700
RQPPPVCPSS GPXLRSASPP DSASVRSTSR AEEPHQPQQV HHQQQQVHHQ
710 720 730 740 750
QQHQSRYATH EYVHCSYEKE VVCDQANPSQ APPQQPAPPV QQHQQQPPPP
760 770 780 790 800
LHHCQQRKHS HSPHHSRHTS PHSHHHHSHH SRHSRRSRRQ GSGSLPGAHQ
810 820 830 840 850
GSANHSVMRP SICTSRRHRS VTDISTTNVC QDPACSDREV QEIMVRRTCC
860 870 880 890 900
NTTATNSSSR TELAQCFAED LYGSSRRPSS CCTSSDYCYQ TDSTSLYGSR
910 920 930 940 950
SSLSRNNSIK SASALVRKHH RSQRSLLPEH RHPSYTSISL RGLNASRPNS
960 970 980 990 1000
QLGSLTSIFD RAKNMAPEGS TLERQSSKGA LGSSELPEYA CSPSPIRWSF
1010 1020 1030 1040 1050
LADGRSPSEM EGAVGGGPER EQEEEDKLDA WQVPEPEPEK KPCRKITTSS
1060 1070 1080 1090 1100
SVYDEGPSTS AAAARKRRGS KGSRGSKGSG SYHCEFEDEA TTTVMFHQDA
1110 1120 1130 1140 1150
GEAYNNCCSN NYNYIQCNTY LDQDLQITSE DIHQYLSKGD ATASDILNNS
1160 1170 1180 1190 1200
KNYPFQPSNA LEFQYKNNFQ QGQANANNNN TNTTNTASSD AAECFQNYRA
1210 1220 1230 1240 1250
ISKETNLNQT STEQLSPTNI NLSTSSNNIN IVFSSSLERN ANEVKFINNR
1260 1270 1280 1290 1300
SGASGGSEMG CEVGHHAGYL PYTYPSYDYT NMSGNSHFEK PLGIDELPKE
1310 1320 1330 1340 1350
FCGLEGAGGG GASTTSEHSS SLPSPQPLTH HQQLHHFESF DAASEHNLLA
1360 1370 1380 1390 1400
AQPMSPGSPL SGSVNPAGDD FVQMHHYHHA NSPHSQSHHS HAHTHTHGHH
1410 1420 1430 1440
VHHLLNHPAY DLTDDQFRLG SALKRVRKRA RKYTDFLRKK
Note: No experimental confirmation available.
Length:1,440
Mass (Da):158,555
Last modified:April 16, 2014 - v4
Checksum:i2F25FBC5E83AA97C
GO
Isoform B1 Publication (identifier: Q8IRI6-2) [UniParc]FASTAAdd to basket
Also known as: C1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     477-481: SMLNC → YVSLH
     482-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:481
Mass (Da):53,171
Checksum:i3026AEEE777DB41E
GO
Isoform D (identifier: Q8IRI6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     476-508: RSMLNCTNSLEPQSMNSGIEHAALMVSEEKTQH → SEDNANGNSVTTADFELSQNDGEEKGGVHAKAQ
     509-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:508
Mass (Da):55,817
Checksum:iF25CA8E2BA9223CC
GO
Isoform L (identifier: Q8IRI6-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAFLCAP → MSMNLSAKLD...HRRKLRLLEQ
     362-362: E → EFFGYVQE
     476-508: RSMLNCTNSLEPQSMNSGIEHAALMVSEEKTQH → SEDNANGNSVTTADFELSQNDGEEKGGVHAKAQ
     509-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:602
Mass (Da):67,096
Checksum:iD5F2B65EA765DF01
GO
Isoform S (identifier: Q8IRI6-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAFLCAP → MATIGDLSMI...HRRKLRLLEQ
     362-411: EMIDWMSYLS...PRPSAMAIAV → ASIVVSRILE...FSDLHMTLKS
     412-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:647
Mass (Da):72,191
Checksum:iC05E8E4FE249C2FB
GO
Isoform U (identifier: Q8IRI6-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAFLCAP → MATIGDLSMI...HRRKLRLLEQ
     8-72: GLTFFLTYSI...QQLYSVAVSI → NQLPTTQSQT...TQTNLSPITT
     73-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:308
Mass (Da):35,173
Checksum:iD56CBE3B1AD45AFC
GO
Isoform Q (identifier: Q8IRI6-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     511-625: LFGTTSFSLT...KKKERTDWLT → P

Note: No experimental confirmation available.
Show »
Length:1,326
Mass (Da):146,370
Checksum:iDA49A545476927C3
GO
Isoform M (identifier: Q8IRI6-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     476-478: RSM → SRA
     479-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:478
Mass (Da):52,729
Checksum:iC1682C041E6CE2BA
GO
Isoform J (identifier: Q8IRI6-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     511-625: LFGTTSFSLT...KKKERTDWLT → P
     663-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:548
Mass (Da):60,199
Checksum:i4E44C85D7C91FF81
GO
Isoform O (identifier: Q8IRI6-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-7: P → PVKRDMVAIKHELDTVQQVKEEIEELREYVDRLEEHTHRRKLRLLEQVCSLNYLPCC
     362-362: E → EFFGYVQE
     476-508: RSMLNCTNSLEPQSMNSGIEHAALMVSEEKTQH → SEDNANGNSVTTADFELSQNDGEEKGGVHAKAQ
     509-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:571
Mass (Da):63,506
Checksum:iC6EBA87A5A544E13
GO
Isoform R (identifier: Q8IRI6-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAFLCAP → MATIGDLSMI...QMQMLFGLAS
     362-362: E → EFFGYVQE
     476-508: RSMLNCTNSLEPQSMNSGIEHAALMVSEEKTQH → SEDNANGNSVTTADFELSQNDGEEKGGVHAKAQ
     509-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:802
Mass (Da):89,630
Checksum:i3686233B4CACD72D
GO
Isoform W (identifier: Q8IRI6-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAFLCAP → MATIGDLSMI...HRRKLRLLEQ
     476-508: RSMLNCTNSLEPQSMNSGIEHAALMVSEEKTQH → SEDNANGNSVTTADFELSQNDGEEKGGVHAKAQ
     509-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:744
Mass (Da):83,045
Checksum:i605975D5CFFFC251
GO
Isoform X (identifier: Q8IRI6-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAFLCAP → MATIGDLSMI...HRRKLRLLEQ
     511-625: LFGTTSFSLT...KKKERTDWLT → P
     663-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:784
Mass (Da):87,427
Checksum:iBBFE9FC3379FBFE8
GO
Isoform V (identifier: Q8IRI6-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAFLCAP → MATIGDLSMI...HRRKLRLLEQ
     477-481: SMLNC → YVSLH
     482-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:717
Mass (Da):80,398
Checksum:i3BAF1601C3481C2F
GO
Isoform E (identifier: Q8IRI6-17) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     362-362: E → EFFGYVQE
     477-481: SMLNC → YVSLH
     482-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:488
Mass (Da):54,042
Checksum:iA8C1F942766F1EF1
GO
Isoform T (identifier: Q8IRI6-18) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-149: MAFLCAPGLT...LVPMYISEIA → MATIGDLSMI...LLEFAQVMFS
     150-1440: Missing.

Note: No experimental confirmation available.
Show »
Length:149
Mass (Da):16,880
Checksum:i641B3D1483ACA4AA
GO

Sequence cautioni

The sequence AAL13347 differs from that shown. Reason: Frameshift at position 49.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0541931 – 149MAFLC…ISEIA → MATIGDLSMISPPTSSISND QDPFGQLPPLPPPLRSTQVL QPLSVFPVSNLSEDSYDYVF GGRRKTPPTTTSTQLKLTSP PVRLRPEDAYRGANINNGRF YRHSFSYAPKRQRHSSRDDR DRESRLRCHGEDEATLRQLL LEFAQVMFS in isoform T. CuratedAdd BLAST149
Alternative sequenceiVSP_0541941 – 7MAFLCAP → MSMNLSAKLDELQRGDRHLE TTVALCEIRTQLQELTKSVE SCQSEVSEVKRDMVAIKHEL DTVQQVKEEIEELREYVDRL EEHTHRRKLRLLEQ in isoform L. Curated7
Alternative sequenceiVSP_0541951 – 7MAFLCAP → MATIGDLSMISPPTSSISND QDPFGQLPPLPPPLRSTQVL QPLSVFPVSNLSEDSYDYVF GGRRKTPPTTTSTQLKLTSP PVRLRPEDAYRGANINNGRF YRHSFSYAPKRQRHSSRDDR DRESRLRCHGEDEATLRQLL LDLQKQVSVMSMNLSAKLDE LQRGDRHLETTVALCEIRTQ LQELTKSVESCQSEVSEVKR DMVAIKHELDTVQQVKEEIE ELREYVDRLEEHTHRRKLRL LEQNQLPTTQSQTTTRPKNH PELPEHPSTQPHKTTDGRNC HHDGQMQMLFGLAS in isoform R. Curated7
Alternative sequenceiVSP_0541961 – 7MAFLCAP → MATIGDLSMISPPTSSISND QDPFGQLPPLPPPLRSTQVL QPLSVFPVSNLSEDSYDYVF GGRRKTPPTTTSTQLKLTSP PVRLRPEDAYRGANINNGRF YRHSFSYAPKRQRHSSRDDR DRESRLRCHGEDEATLRQLL LDLQKQVSVMSMNLSAKLDE LQRGDRHLETTVALCEIRTQ LQELTKSVESCQSEVSEVKR DMVAIKHELDTVQQVKEEIE ELREYVDRLEEHTHRRKLRL LEQ in isoform S, isoform U, isoform W, isoform X and isoform V. 1 Publication7
Alternative sequenceiVSP_0541977P → PVKRDMVAIKHELDTVQQVK EEIEELREYVDRLEEHTHRR KLRLLEQVCSLNYLPCC in isoform O. Curated1
Alternative sequenceiVSP_0541988 – 72GLTFF…VAVSI → NQLPTTQSQTTTRPKNHPEL PEHPSTQPHKTTDGRNCHHD GQMQMLFGLASVSVHTQTNL SPITT in isoform U. CuratedAdd BLAST65
Alternative sequenceiVSP_05419973 – 1440Missing in isoform U. CuratedAdd BLAST1368
Alternative sequenceiVSP_054200150 – 1440Missing in isoform T. CuratedAdd BLAST1291
Alternative sequenceiVSP_054201362 – 411EMIDW…MAIAV → ASIVVSRILESCSCSCRVMP ANVNAKMPASLGLHLFVPRP FSDLHMTLKS in isoform S. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_054202362E → EFFGYVQE in isoform L, isoform E, isoform O and isoform R. 1 Publication1
Alternative sequenceiVSP_054203412 – 1440Missing in isoform S. 1 PublicationAdd BLAST1029
Alternative sequenceiVSP_054204476 – 508RSMLN…EKTQH → SEDNANGNSVTTADFELSQN DGEEKGGVHAKAQ in isoform D, isoform L, isoform O, isoform R and isoform W. CuratedAdd BLAST33
Alternative sequenceiVSP_054205476 – 478RSM → SRA in isoform M. Curated3
Alternative sequenceiVSP_054206477 – 481SMLNC → YVSLH in isoform B, isoform E and isoform V. 2 Publications5
Alternative sequenceiVSP_054207479 – 1440Missing in isoform M. CuratedAdd BLAST962
Alternative sequenceiVSP_054208482 – 1440Missing in isoform B, isoform E and isoform V. 2 PublicationsAdd BLAST959
Alternative sequenceiVSP_054209509 – 1440Missing in isoform D, isoform L, isoform O, isoform R and isoform W. CuratedAdd BLAST932
Alternative sequenceiVSP_054210511 – 625LFGTT…TDWLT → P in isoform Q, isoform J and isoform X. CuratedAdd BLAST115
Alternative sequenceiVSP_054211663 – 1440Missing in isoform J and isoform X. CuratedAdd BLAST778

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF064703 mRNA. Translation: AAC36683.2.
AE014296 Genomic DNA. Translation: AAF47434.2.
AE014296 Genomic DNA. Translation: AAN11454.5.
AE014296 Genomic DNA. Translation: ABW08432.1.
AE014296 Genomic DNA. Translation: ABW08433.1.
AE014296 Genomic DNA. Translation: ABW08434.2.
AE014296 Genomic DNA. Translation: ABW08435.2.
AE014296 Genomic DNA. Translation: AGB93925.1.
AE014296 Genomic DNA. Translation: AGB93926.1.
AE014296 Genomic DNA. Translation: AGB93927.1.
AE014296 Genomic DNA. Translation: AGB93928.1.
AE014296 Genomic DNA. Translation: AGB93929.1.
AE014296 Genomic DNA. Translation: AGB93930.1.
AE014296 Genomic DNA. Translation: AGB93931.1.
AE014296 Genomic DNA. Translation: AGB93932.1.
AE014296 Genomic DNA. Translation: AGB93933.1.
AY059441 mRNA. Translation: AAL13347.1. Frameshift.
BT011383 mRNA. Translation: AAR96175.1.
RefSeqiNP_001097467.1. NM_001103997.3. [Q8IRI6-3]
NP_001097468.1. NM_001103998.3. [Q8IRI6-17]
NP_001097469.2. NM_001103999.4. [Q8IRI6-6]
NP_001097470.2. NM_001104000.2. [Q8IRI6-9]
NP_001261230.1. NM_001274301.1. [Q8IRI6-10]
NP_001261231.1. NM_001274302.1. [Q8IRI6-11]
NP_001261232.1. NM_001274303.1. [Q8IRI6-12]
NP_001261233.1. NM_001274304.1. [Q8IRI6-13]
NP_001261234.1. NM_001274305.1. [Q8IRI6-18]
NP_001261235.1. NM_001274306.1. [Q8IRI6-8]
NP_001261236.1. NM_001274307.1. [Q8IRI6-16]
NP_001261237.1. NM_001274308.1. [Q8IRI6-14]
NP_001261238.1. NM_001274309.1. [Q8IRI6-15]
NP_001286896.1. NM_001299967.1. [Q8IRI6-11]
NP_523878.1. NM_079154.3. [Q8IRI6-2]
NP_612073.2. NM_138229.2. [Q8IRI6-5]
NP_728557.1. NM_167845.3. [Q8IRI6-2]
NP_728558.5. NM_167846.3. [Q8IRI6-7]
UniGeneiDm.4347.

Genome annotation databases

EnsemblMetazoaiFBtr0333501; FBpp0305685; FBgn0264574. [Q8IRI6-5]
GeneIDi38109.
KEGGidme:Dmel_CG43946.
UCSCiCG1086-RD. d. melanogaster.
CG1086-RE. d. melanogaster.
CG1086-RF. d. melanogaster.
CG13908-RA. d. melanogaster.
CG13908-RB. d. melanogaster.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF064703 mRNA. Translation: AAC36683.2.
AE014296 Genomic DNA. Translation: AAF47434.2.
AE014296 Genomic DNA. Translation: AAN11454.5.
AE014296 Genomic DNA. Translation: ABW08432.1.
AE014296 Genomic DNA. Translation: ABW08433.1.
AE014296 Genomic DNA. Translation: ABW08434.2.
AE014296 Genomic DNA. Translation: ABW08435.2.
AE014296 Genomic DNA. Translation: AGB93925.1.
AE014296 Genomic DNA. Translation: AGB93926.1.
AE014296 Genomic DNA. Translation: AGB93927.1.
AE014296 Genomic DNA. Translation: AGB93928.1.
AE014296 Genomic DNA. Translation: AGB93929.1.
AE014296 Genomic DNA. Translation: AGB93930.1.
AE014296 Genomic DNA. Translation: AGB93931.1.
AE014296 Genomic DNA. Translation: AGB93932.1.
AE014296 Genomic DNA. Translation: AGB93933.1.
AY059441 mRNA. Translation: AAL13347.1. Frameshift.
BT011383 mRNA. Translation: AAR96175.1.
RefSeqiNP_001097467.1. NM_001103997.3. [Q8IRI6-3]
NP_001097468.1. NM_001103998.3. [Q8IRI6-17]
NP_001097469.2. NM_001103999.4. [Q8IRI6-6]
NP_001097470.2. NM_001104000.2. [Q8IRI6-9]
NP_001261230.1. NM_001274301.1. [Q8IRI6-10]
NP_001261231.1. NM_001274302.1. [Q8IRI6-11]
NP_001261232.1. NM_001274303.1. [Q8IRI6-12]
NP_001261233.1. NM_001274304.1. [Q8IRI6-13]
NP_001261234.1. NM_001274305.1. [Q8IRI6-18]
NP_001261235.1. NM_001274306.1. [Q8IRI6-8]
NP_001261236.1. NM_001274307.1. [Q8IRI6-16]
NP_001261237.1. NM_001274308.1. [Q8IRI6-14]
NP_001261238.1. NM_001274309.1. [Q8IRI6-15]
NP_001286896.1. NM_001299967.1. [Q8IRI6-11]
NP_523878.1. NM_079154.3. [Q8IRI6-2]
NP_612073.2. NM_138229.2. [Q8IRI6-5]
NP_728557.1. NM_167845.3. [Q8IRI6-2]
NP_728558.5. NM_167846.3. [Q8IRI6-7]
UniGeneiDm.4347.

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi63662. 2 interactors.
IntActiQ8IRI6. 2 interactors.
MINTiMINT-1021254.
STRINGi7227.FBpp0305685.

Proteomic databases

PaxDbiQ8IRI6.
PRIDEiQ8IRI6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0333501; FBpp0305685; FBgn0264574. [Q8IRI6-5]
GeneIDi38109.
KEGGidme:Dmel_CG43946.
UCSCiCG1086-RD. d. melanogaster.
CG1086-RE. d. melanogaster.
CG1086-RF. d. melanogaster.
CG13908-RA. d. melanogaster.
CG13908-RB. d. melanogaster.

Organism-specific databases

CTDi38109.
FlyBaseiFBgn0264574. Glut1.

Phylogenomic databases

eggNOGiKOG0569. Eukaryota.
COG0477. LUCA.
GeneTreeiENSGT00760000119022.
HOGENOMiHOG000030203.
InParanoidiQ8IRI6.
KOiK07299.
OMAiIKEFFGY.
OrthoDBiEOG091G0A9K.

Miscellaneous databases

ChiTaRSiGlut1. fly.
GenomeRNAii38109.
PROiQ8IRI6.

Gene expression databases

BgeeiFBgn0264574.
ExpressionAtlasiQ8IRI6. baseline.
GenevisibleiQ8IRI6. DM.

Family and domain databases

CDDicd06174. MFS. 1 hit.
InterProiIPR020846. MFS_dom.
IPR005828. MFS_sugar_transport-like.
IPR003663. Sugar/inositol_transpt.
IPR005829. Sugar_transporter_CS.
[Graphical view]
PfamiPF00083. Sugar_tr. 1 hit.
[Graphical view]
PRINTSiPR00171. SUGRTRNSPORT.
SUPFAMiSSF103473. SSF103473. 2 hits.
TIGRFAMsiTIGR00879. SP. 1 hit.
PROSITEiPS50850. MFS. 1 hit.
PS00217. SUGAR_TRANSPORT_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiGTR1_DROME
AccessioniPrimary (citable) accession number: Q8IRI6
Secondary accession number(s): A8JNH6
, A8JNH8, A8JNH9, M9PBH4, M9PBH5, M9PDK7, M9PDL1, M9PDS4, M9PDS9, M9PE46, M9PGN5, M9PGP2, O77131, Q0E8K0, Q6NNA9, Q95TE8, Q9V409, Q9W0L2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 12, 2005
Last sequence update: April 16, 2014
Last modified: November 30, 2016
This is version 120 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.