Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcription-associated protein 1

Gene

Nipped-A

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Part of the Tip60 chromatin-remodeling complex which is involved in DNA repair (PubMed:15528408). Upon induction of DNA double-strand breaks, this complex acetylates phosphorylated H2AV in nucleosomes and exchanges it with unmodified H2AV (PubMed:15528408). During wing development, required for activity of Notch and its coactivator mam (PubMed:16508010). Function in promoting mam function is likely to involve both the Tip60 and SAGA complexes (PubMed:16508010).2 Publications

Miscellaneous

Although strongly related to the PI3/PI4-kinase family, it lacks the typical motifs that constitute the catalytic site of PI3/PI4-kinase proteins, suggesting that it probably lacks such activity.

GO - Molecular functioni

GO - Biological processi

  • DNA repair Source: GO_Central
  • histone acetylation Source: UniProtKB
  • histone exchange Source: UniProtKB
  • histone H3 acetylation Source: FlyBase
  • mitotic cytokinesis Source: FlyBase
  • positive regulation of Notch signaling pathway Source: FlyBase
  • regulation of transcription, DNA-templated Source: UniProtKB
  • transcription, DNA-templated Source: UniProtKB
  • wing disc pattern formation Source: FlyBase

Keywordsi

Molecular functionActivator, Chromatin regulator
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-DME-201722. Formation of the beta-catenin:TCF transactivating complex.
R-DME-5689880. Ub-specific processing proteases.
SignaLinkiQ8I8U7.

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription-associated protein 1
Alternative name(s):
dTRA1
Gene namesi
Name:Nipped-A
Synonyms:Tra1
ORF Names:CG2905
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome 2R

Organism-specific databases

FlyBaseiFBgn0053554. Nipped-A.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Chromosome, Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000888531 – 3790Transcription-associated protein 1Add BLAST3790

Proteomic databases

PaxDbiQ8I8U7.
PRIDEiQ8I8U7.

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Developmental stagei

Expressed both maternally and zygotically.1 Publication

Gene expression databases

ExpressionAtlasiQ8I8U7. differential.
GenevisibleiQ8I8U7. DM.

Interactioni

Subunit structurei

Component of the Tip60 chromatin-remodeling complex which contains the catalytic subunit Tip60 and the subunits Domino, Tra1, Brd8, E(Pc), DMAP1, Pontin, Reptin, Ing3, Act87E, BAP55, Mrg15, MrgBP, Gas41 and YL-1 (PubMed:15528408). Probable component of some SAGA complex (PubMed:12697829). Interacts with Spt3, Gcn5, Ada3 and Ada2b (PubMed:12697829).2 Publications

Protein-protein interaction databases

BioGridi61398. 29 interactors.
IntActiQ8I8U7. 17 interactors.
STRINGi7227.FBpp0085431.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati98 – 136HEAT 1Sequence analysisAdd BLAST39
Repeati335 – 381HEAT 2Sequence analysisAdd BLAST47
Repeati740 – 778HEAT 3Sequence analysisAdd BLAST39
Repeati1185 – 1223HEAT 4Sequence analysisAdd BLAST39
Repeati1332 – 1370HEAT 5Sequence analysisAdd BLAST39
Repeati1826 – 1864HEAT 6Sequence analysisAdd BLAST39
Domaini2627 – 3173FATPROSITE-ProRule annotationAdd BLAST547
Domaini3457 – 3756PI3K/PI4KPROSITE-ProRule annotationAdd BLAST300
Domaini3758 – 3790FATCPROSITE-ProRule annotationAdd BLAST33

Sequence similaritiesi

Belongs to the PI3/PI4-kinase family. TRA1 subfamily.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0889. Eukaryota.
COG5032. LUCA.
GeneTreeiENSGT00390000017961.
InParanoidiQ8I8U7.
KOiK08874.
OMAiDYLDPIM.
OrthoDBiEOG091G0024.
PhylomeDBiQ8I8U7.

Family and domain databases

InterProiView protein in InterPro
IPR016024. ARM-type_fold.
IPR003152. FATC_dom.
IPR011009. Kinase-like_dom_sf.
IPR000403. PI3/4_kinase_cat_dom.
IPR003151. PIK-rel_kinase_FAT.
IPR014009. PIK_FAT.
IPR033317. TRA1/TRRAP.
PANTHERiPTHR11139:SF1. PTHR11139:SF1. 1 hit.
PfamiView protein in Pfam
PF02259. FAT. 1 hit.
PF02260. FATC. 1 hit.
PF00454. PI3_PI4_kinase. 1 hit.
SMARTiView protein in SMART
SM01343. FATC. 1 hit.
SM00146. PI3Kc. 1 hit.
SUPFAMiSSF48371. SSF48371. 7 hits.
SSF56112. SSF56112. 2 hits.
PROSITEiView protein in PROSITE
PS51189. FAT. 1 hit.
PS51190. FATC. 1 hit.
PS50290. PI3_4_KINASE_3. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform EImported (identifier: Q8I8U7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSVIENVPVN TFRNYLNILN DSSSKDELKL KATQELSEHF EMIMQSPAYP
60 70 80 90 100
SFLDNSLKIF MRILQDGEPQ FIQENTMQHI RKLILEMIHR LPITESLRQH
110 120 130 140 150
VKTIITMMLK ILKTDNEENV LVCLRIIIEL HKHFRPSFNS EIQLFLGFVK
160 170 180 190 200
EIYTNLPNHL TSIFETSNDV WVTDLKDLNL EVLLSESYSV RTIHVEKALD
210 220 230 240 250
SNSQQQIYNL LPRGILSLKV LQELPIIVVL MYQIYKNAVH QEVSEFIPLI
260 270 280 290 300
LTTINLQPTV TRRNSPQKEI YVEFMGAQIK TLSFLAYIVR IFQEVVIASS
310 320 330 340 350
LSVTSGMLNL MKNCPKEAAH LRKELLIAAR HIFATDLRQK FIPSIEQLFD
360 370 380 390 400
EDLLIGKGVT LDSIRPLAYS TLADLAHHVR QSLNIDVLIK AVNLFSKNVH
410 420 430 440 450
DESLAVGIQT MSCKLLLNLV DCLRHHSETE PQRSKALLSK LLKVFVKKFE
460 470 480 490 500
TIAKIQLPLI IQKCKGHAFS GALVNSSGNA SLSHINAPDL KDDISNIQVS
510 520 530 540 550
ASGSQWIYSV NVAEFRSLVK TLVGGVKTIT WGFFNSKFQL TDTKLANHEK
560 570 580 590 600
IFGPEIVCSY IDLVYYAMEA LDIYTINVNP NQQRTSGLIS RSKEEKEVLE
610 620 630 640 650
HFSGIFLMMH SQNFQEIFST TINFLVERIY KNQSLQVIAN SFLANPTTSP
660 670 680 690 700
LFATVLVEYL LNKMEEMGSN LERSNLYLRL FKLVFGSVSL FPVENEQMLR
710 720 730 740 750
PHLHKIVNRS MELALISEEP YNYFLLLRAL FRSIGGGSHD LLYQEFLPLL
760 770 780 790 800
PNLLEGLNRL QSGFHKQHMR DLFVELCLTV PVRLSSLLPY LPMLMDPLVS
810 820 830 840 850
ALNGSPTLIS QGLRTLELCV DNLQPDFLYD HIQPVRAALM QALWKTLRNQ
860 870 880 890 900
DNAALVAFRV LGKFGGGNRK MMVEPQALSY IINDKPTISI VTYFQEYETP
910 920 930 940 950
IDFPVDEAIK SAFRALGSNS TDQFYRRQSW EVIRCFLAAF ISLDDEKHML
960 970 980 990 1000
LKLFTHVDFV ENKIMNWSTF QHKAGNETVR ETHQTALIGM LVASATKDLR
1010 1020 1030 1040 1050
DSVCPVMAAV VRHYTMVAIA QQAGPFPQKG YQATHGIDPM ILIDALASCM
1060 1070 1080 1090 1100
GHEEKELCKP GIACMGIILD TATNIMGNKD RACKLPIIQY LAEKMVSLCY
1110 1120 1130 1140 1150
DRPWYSKVGG CQAIQFLCKH MSLRALFQNL FNFLKAFMFV LMDLEGDVSN
1160 1170 1180 1190 1200
GAIEITKSYM KSMLEICLTP INECYKNIDL KDLQAKATYE VIHELVRHIT
1210 1220 1230 1240 1250
SPNTIVREES MVLLKHIGTI QSKTVSEVMD PHKDVLADII PPKKHLLRHQ
1260 1270 1280 1290 1300
PANAQIGLMD GNTFCTTLEP RLFTIDLTNT YHKLFFHELL TLSEAEDATL
1310 1320 1330 1340 1350
AKLDCYKNVP NLIPLRTSAL RALAACHYIS DIGYKEKIIN IIFKVMESDK
1360 1370 1380 1390 1400
SELQTTAFHC MKHFITGVTL EKEKVQSAMR PLLLKLGDHR NLSIPAIKRL
1410 1420 1430 1440 1450
SYFTQIFPQM FNEKLSEQIL QHCSKIMEIF VSEYKSTSPN VNFFASSKGG
1460 1470 1480 1490 1500
EYEQKIVILI EMFFYISASV KYIEKLCQLV LKTEKNLMIE ASSPYREALI
1510 1520 1530 1540 1550
KFLQRFPTET VDLFLTESLM IDPQWNRLFI YLLKHETGVS FRAVIKSSRY
1560 1570 1580 1590 1600
NNLIHYLNTH TEFPEALKYE IQHQAVLIIF TLMESDDQWI PTRQDIVDAL
1610 1620 1630 1640 1650
KNCWQNYLST LSSEDVLCDL WHLIGKILLH YFSNNTNDIE LLFQLLRALC
1660 1670 1680 1690 1700
FRFIPDVYFL RDFLQHTVAQ SFTVNWKRNA FFYFVENFNN SFLSEELKAK
1710 1720 1730 1740 1750
IITAVIIPCF AVSFDKGEGN KLIGAPPTPY QEDEKNIVSV FINKVFDPDK
1760 1770 1780 1790 1800
QYDDAVRIAL LQLACLLVER ASQHIHDGDA NNKRQGNKLR RLMTFAWPCL
1810 1820 1830 1840 1850
LSKSSVDPTA RYHGHLLLSH IIARLAIHKK IVLQVFHSLL KGHALEARSI
1860 1870 1880 1890 1900
VKQALDVLTP AMPLRMEDGN TMLTHWTKKI IVEEGHAMQQ LFHILQLIIR
1910 1920 1930 1940 1950
HYKVYFPVRH QLVQHLINYM QRLGFPPTAS IEHKKLAVDL AEVIIKWELH
1960 1970 1980 1990 2000
RIKDDRETKT DGTEEELIQE SSVKRSGIDL VETRKKSFDI IRETTVQGVG
2010 2020 2030 2040 2050
SHTKPDDILR SIDKSYCDTV LNFLIRLACQ VNDPQAPILS PGESLSRRCV
2060 2070 2080 2090 2100
MLLKMAMRPE IWPQPFDIKL NWLDKVLATV ETPHHNLNNI CTGIDFLTFL
2110 2120 2130 2140 2150
TTILSPDQLV SIIRPVQRGL SLCIIHQNTR IVRLMHMFLT RIMAIFPPDT
2160 2170 2180 2190 2200
QHKHEDLDLL YTAVSKMIAE NLTSYEKSPQ PNASSLFGTL MILKACTTNN
2210 2220 2230 2240 2250
ASYIDRILVQ FIRVLNHLTR DHINTIGGNT VISQSPDSNA LPLELLVLSL
2260 2270 2280 2290 2300
ELIKNRIFVM SVEIRKLFIG TILVSLIEKS TEVKIIKCII KMLDEWIKTK
2310 2320 2330 2340 2350
EPNVMTQVPS IREKSALLVK LMQNVEKKFT DEIELNIQFL EIINFIYRDE
2360 2370 2380 2390 2400
ILKQTELTNK LEGAFLNGLR FQNPNVRSKF FEILDSSMRR RLHDRLLYII
2410 2420 2430 2440 2450
CSQAWDTIGS HYWIKQCIEL LILTANTMMQ IQCSNEQFKI PSITSVIPVN
2460 2470 2480 2490 2500
SSETQENSFV SFLSSHSESF DIIQTVDDKD DVYDIDLNAD RKEDCQQILP
2510 2520 2530 2540 2550
NRRVTLVELV YKQAEFLEAN RNIRTDQMLV ATSQLCHIDT QLAQSVWLSM
2560 2570 2580 2590 2600
FPRIWSIFTE DQRCNITKEL IPFLSSGTNV NQKDCHPSTL NTFVESLTKC
2610 2620 2630 2640 2650
APPIYIPPNL LAYLGKSHNL WHRAILVLED MAVNQSMQSK DIDGGENQFS
2660 2670 2680 2690 2700
DLDVQQSNNI FDSLSKMYSS MHEEDLWAGL WLKFAHYPET NIAVSYEQMG
2710 2720 2730 2740 2750
FFEEAQGAYD LAMTKFKQDL SNGVVNTYVN SELLLWENHW MRCAKELNQW
2760 2770 2780 2790 2800
DILLDYAQTN KDKNMFLILE SSWRVPDWNL MKIALAKTEQ CYLKHYGFKI
2810 2820 2830 2840 2850
NLYKGYLSIL HQEERQTGNI ERYVEIASSL CIREWRRLPN IVSHIHLPYL
2860 2870 2880 2890 2900
QASQQIMELH EASQIHQGLA QSRNNSLHDM KAIVKTWRNR LPIISDDLSH
2910 2920 2930 2940 2950
WSDIFTWRQH HYQIITQHLE QQSDQGSTML GVHASAQAII SFGKIARKHN
2960 2970 2980 2990 3000
LTGVCQETLS RIYTIPSVPI VDCFQKIRQQ VKCYLQMPST SGKNEINEAL
3010 3020 3030 3040 3050
EVIESTNLKY FTGEMNAEFY ALKGLLLAQI GRSEEAGKSF SVAAQLHDGL
3060 3070 3080 3090 3100
TKAWAMWGDY MEQIFLKERK ITLAVDALIC YLQASRNQIE SKTRKYIAKV
3110 3120 3130 3140 3150
LWFLSYDNNT KILISTLEKH VAGIPPSYWL PWIPQLLCCL EQFEGDVILN
3160 3170 3180 3190 3200
LLSQIGRLYP QAVYFPIRTL YLTLKIEQRE KHKTAEQAVK SSCSNIDGTT
3210 3220 3230 3240 3250
LSFGRGASHG NIPSINPIKA TPPMWRCSKV MQLQREVHPT ILSSLEGIVD
3260 3270 3280 3290 3300
QMVWFRESWT EEVLRQLRQG LIKCYAIAFE KRDTVQHSTI TPHTLHFVKK
3310 3320 3330 3340 3350
LGSTFGIGIE NVPGSVTSSI SNSAASESLA RRAQVTFQDP VFQKMKEQFT
3360 3370 3380 3390 3400
NDFDFSKPGA MKLHNLISKL KTWIKVLETK VKKLPTSFLI EDKCRFLSNF
3410 3420 3430 3440 3450
SQKTAEVELP GELLIPLSSH YYVRIARFMP RVEIVQKNNT AARRLYIRGT
3460 3470 3480 3490 3500
NGKIYPYLVV LDSGLGDARR EERVLQLKRM LNYYLEKQKE TSRRFLNITV
3510 3520 3530 3540 3550
PRVVPISPQM RLAEDNPNSI SLLKIFKKCC QSMQVDYDMP IVKYYDRLSE
3560 3570 3580 3590 3600
VQARGTPTTH TLLREIFSEI QWTMVPKTLL KHWALKTFLA ATDFWHFRKM
3610 3620 3630 3640 3650
LTLQLALAFL CEHALNLTRL NADMMYLHQD SGLMNISYFK FDVNDDKCQL
3660 3670 3680 3690 3700
NQHRPVPFRL TPNVGEFITH FGITGPLSAA IVATARCFIQ PNYKLSSILQ
3710 3720 3730 3740 3750
TILRDEIIAL QKKGFRECKL IEGSEDRYSD GNCMEHSVNI VNSAVDIIMT
3760 3770 3780 3790
RFNKISYFDS IENKKISVLV QSATNIDNLC RMDPAWHPWL
Length:3,790
Mass (Da):435,330
Last modified:January 31, 2018 - v4
Checksum:i366CF25BBC7C5435
GO
Isoform FImported (identifier: Q8I8U7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1999-2048: VGSHTKPDDILRSIDKSYCDTVLNFLIRLACQVNDPQAPILSPGESLSRR → K

Show »
Length:3,741
Mass (Da):429,936
Checksum:iF8E04B8E5873D5D8
GO

Sequence cautioni

The sequence AAM11122 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAN52145 differs from that shown. Contaminating sequence. Insertion of several transposable element sequences.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti468A → T in AAM11122 (PubMed:12537569).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0593121999 – 2048VGSHT…SLSRR → K in isoform F. Add BLAST50

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY142217 mRNA. Translation: AAN52145.1. Sequence problems.
AE013599 Genomic DNA. Translation: ABI31023.2.
AE013599 Genomic DNA. Translation: ABV53702.2.
AY094769 mRNA. Translation: AAM11122.1. Different initiation.
DQ352451 mRNA. Translation: ABD22987.1.
RefSeqiNP_001097192.2. NM_001103722.3. [Q8I8U7-1]
NP_001303335.1. NM_001316406.1. [Q8I8U7-2]
UniGeneiDm.12140.

Genome annotation databases

EnsemblMetazoaiFBtr0303293; FBpp0292385; FBgn0053554. [Q8I8U7-1]
FBtr0347556; FBpp0312589; FBgn0053554. [Q8I8U7-2]
GeneIDi35483.
KEGGidme:Dmel_CG33554.
UCSCiCG33554-RA. d. melanogaster.
CG33554-RD. d. melanogaster.

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiTRA1_DROME
AccessioniPrimary (citable) accession number: Q8I8U7
Secondary accession number(s): A0A140SQB4
, A8DY44, Q2EZ47, Q8T3L7, Q9V9E9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2003
Last sequence update: January 31, 2018
Last modified: March 28, 2018
This is version 137 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome