Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Potassium voltage-gated channel protein shk-1

Gene

shk-1

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Mediates the voltage-dependent potassium ion permeability of excitable membranes. Has an important role in repolarization and in regulating the pattern of action potential firing. Isoform a expresses currents in a more depolarized voltage range than isoform d.2 Publications

GO - Molecular functioni

  • delayed rectifier potassium channel activity Source: WormBase

GO - Biological processi

  • potassium ion transmembrane transport Source: WormBase
  • protein homooligomerization Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Ion channel, Potassium channel, Voltage-gated channel

Keywords - Biological processi

Ion transport, Potassium transport, Transport

Keywords - Ligandi

Potassium

Protein family/group databases

TCDBi1.A.1.2.20. the voltage-gated ion channel (vic) superfamily.

Names & Taxonomyi

Protein namesi
Recommended name:
Potassium voltage-gated channel protein shk-1
Gene namesi
Name:shk-1Imported
ORF Names:ZK1321.2
OrganismiCaenorhabditis elegans
Taxonomic identifieri6239 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
Proteomesi
  • UP000001940 Componenti: Chromosome II

Organism-specific databases

WormBaseiZK1321.2a; CE32769; WBGene00014261; shk-1.
ZK1321.2b; CE32770; WBGene00014261; shk-1.
ZK1321.2c; CE32771; WBGene00014261; shk-1.
ZK1321.2d; CE32772; WBGene00014261; shk-1.
ZK1321.2e; CE36966; WBGene00014261; shk-1.
ZK1321.2f; CE40295; WBGene00014261; shk-1.
ZK1321.2g; CE45447; WBGene00014261; shk-1.

Subcellular locationi

  • Membrane By similarity; Multi-pass membrane protein By similarity

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 275CytoplasmicSequence analysisAdd BLAST275
Transmembranei276 – 296Helical; Name=Segment S1Sequence analysisAdd BLAST21
Topological domaini297 – 322ExtracellularSequence analysisAdd BLAST26
Transmembranei323 – 343Helical; Name=Segment S2Sequence analysisAdd BLAST21
Topological domaini344 – 356CytoplasmicSequence analysisAdd BLAST13
Transmembranei357 – 377Helical; Name=Segment S3Sequence analysisAdd BLAST21
Topological domaini378 – 425ExtracellularSequence analysisAdd BLAST48
Transmembranei426 – 446Helical; Voltage-sensor; Name=Segment S4Sequence analysisAdd BLAST21
Topological domaini447 – 458CytoplasmicSequence analysisAdd BLAST12
Transmembranei459 – 479Helical; Name=Segment S5Sequence analysisAdd BLAST21
Topological domaini480 – 486ExtracellularSequence analysis7
Transmembranei487 – 507Helical; Name=Segment S6Sequence analysisAdd BLAST21
Topological domaini508 – 536CytoplasmicSequence analysisAdd BLAST29

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Disruption phenotypei

Delayed spike repolarization.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00004206231 – 536Potassium voltage-gated channel protein shk-1Add BLAST536

Proteomic databases

PaxDbiQ8I4B0.
PeptideAtlasiQ8I4B0.

Expressioni

Tissue specificityi

Expressed in a variety of interneurons and sensory neurons, as well as body wall muscle.2 Publications

Gene expression databases

BgeeiWBGene00014261.

Interactioni

Protein-protein interaction databases

STRINGi6239.ZK1321.2c.

Structurei

3D structure databases

ProteinModelPortaliQ8I4B0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1545. Eukaryota.
COG1226. LUCA.
GeneTreeiENSGT00760000118846.
HOGENOMiHOG000231015.
InParanoidiQ8I4B0.
KOiK04874.
OMAiDFQEENL.
OrthoDBiEOG091G10NU.
PhylomeDBiQ8I4B0.

Family and domain databases

Gene3Di1.20.120.350. 1 hit.
InterProiIPR027359. Channel_four-helix_dom.
IPR005821. Ion_trans_dom.
IPR003968. K_chnl_volt-dep_Kv.
IPR011333. SKP1/BTB/POZ.
IPR003131. T1-type_BTB.
IPR028325. VG_K_chnl.
[Graphical view]
PANTHERiPTHR11537. PTHR11537. 1 hit.
PfamiPF02214. BTB_2. 1 hit.
PF00520. Ion_trans. 1 hit.
[Graphical view]
PRINTSiPR00169. KCHANNEL.
PR01491. KVCHANNEL.
SUPFAMiSSF54695. SSF54695. 1 hit.

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform c1 Publication (identifier: Q8I4B0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRFGGQRRCI ESSDDNDSID SMSIQQKNKE KEEWKWAQSL ARRLEQVLNV
60 70 80 90 100
HPEKYQNGCS SQRPSRQPSP VEQLAPIRSH SADFGRAAEM ASGNSEEGKG
110 120 130 140 150
MLLRNGDDRI RLPSPQRGTP DTSSTQGHPY TDQIVTINVS GMRFQTFEST
160 170 180 190 200
LSRYPNSLLG DRNKRQHFFV SDTNEFFFDR HRTTSSSFTF EIRNYLFESI
210 220 230 240 250
LYIYQSGGRV KRPEIVPIDI FLKEMRFFQM GDDLLEEFWI AEGYEKPKEV
260 270 280 290 300
MMPNNKTQRK IWELMEYPDS SLSARIIAFI SIAVIALSII SFCWETVPSD
310 320 330 340 350
IEEKPINNSA TAELLDEMDE KHYSPFFWIE LMCILWFTIE LILRFISCPC
360 370 380 390 400
KVTFATSVLN IIDFVAIAPF FVNFFFADTS KSNSSMSFAV LRVLRLVRVF
410 420 430 440 450
RVFKLSRHSV GLQILGKTFR SSVQEFCLLI FFMAIALVLF ASGMYFAEQG
460 470 480 490 500
EPNSKFTSIP ASFWFVLVTM TTVGYGDLVP LSPFGKVVGG MCAMIGVLTL
510 520 530
ALPVPIIVAN FKHFYRQENR LASMKSKGDD ADDDIA
Note: No experimental confirmation available.Curated
Length:536
Mass (Da):61,234
Last modified:March 1, 2003 - v1
Checksum:i9662A84009CF0632
GO
Isoform b1 Publication (identifier: Q8I4B0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     185-196: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:524
Mass (Da):59,789
Checksum:i4C9297157383F759
GO
Isoform d1 Publication (identifier: Q8I4B0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MRFGGQRRCIESSDDNDSIDSMSIQQKNKEKEEWKWAQSLA → MIDSLI

Note: No experimental confirmation available.Curated
Show »
Length:501
Mass (Da):57,092
Checksum:iD4DD985C2408D1A3
GO
Isoform a1 Publication (identifier: Q8I4B0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-85: RRLEQVLNVHPEKYQNGCSSQRPSRQPSPVEQLAPIRSHSADFG → S
     185-196: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:481
Mass (Da):54,893
Checksum:iE3B676ED326076C0
GO
Isoform e1 Publication (identifier: Q8I4B0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-85: MRFGGQRRCI...PIRSHSADFG → MWRFNRIKS
     185-196: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:448
Mass (Da):51,210
Checksum:i9FD7F69E72C95645
GO
Isoform f1 Publication (identifier: Q8I4B0-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-89: Missing.
     185-196: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:435
Mass (Da):49,563
Checksum:i623A4AC29A712E09
GO
Isoform g1 Publication (identifier: Q8I4B0-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     126-536: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:125
Mass (Da):14,057
Checksum:i72547C0E6847CA57
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0445701 – 89Missing in isoform f. 1 PublicationAdd BLAST89
Alternative sequenceiVSP_0445711 – 85MRFGG…SADFG → MWRFNRIKS in isoform e. 1 PublicationAdd BLAST85
Alternative sequenceiVSP_0445721 – 41MRFGG…AQSLA → MIDSLI in isoform d. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_04457342 – 85RRLEQ…SADFG → S in isoform a. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_044574126 – 536Missing in isoform g. 1 PublicationAdd BLAST411
Alternative sequenceiVSP_044575185 – 196Missing in isoform b, isoform a, isoform e and isoform f. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z48584 Genomic DNA. Translation: CAA88477.2.
Z48584 Genomic DNA. Translation: CAD57715.1.
Z48584 Genomic DNA. Translation: CAD57716.1.
Z48584 Genomic DNA. Translation: CAD57717.1.
Z48584 Genomic DNA. Translation: CAH04712.1.
Z48584 Genomic DNA. Translation: CAK55179.1.
Z48584 Genomic DNA. Translation: CBX53352.1.
RefSeqiNP_001022516.1. NM_001027345.2. [Q8I4B0-5]
NP_001040829.1. NM_001047364.2. [Q8I4B0-6]
NP_001254226.1. NM_001267297.1. [Q8I4B0-7]
NP_496104.2. NM_063703.4. [Q8I4B0-4]
NP_871934.1. NM_182134.3. [Q8I4B0-2]
NP_871935.1. NM_182135.4. [Q8I4B0-1]
NP_871936.1. NM_182136.4. [Q8I4B0-3]
UniGeneiCel.7785.

Genome annotation databases

EnsemblMetazoaiZK1321.2c; ZK1321.2c; WBGene00014261. [Q8I4B0-1]
GeneIDi174536.
KEGGicel:CELE_ZK1321.2.
UCSCiZK1321.2a. c. elegans.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z48584 Genomic DNA. Translation: CAA88477.2.
Z48584 Genomic DNA. Translation: CAD57715.1.
Z48584 Genomic DNA. Translation: CAD57716.1.
Z48584 Genomic DNA. Translation: CAD57717.1.
Z48584 Genomic DNA. Translation: CAH04712.1.
Z48584 Genomic DNA. Translation: CAK55179.1.
Z48584 Genomic DNA. Translation: CBX53352.1.
RefSeqiNP_001022516.1. NM_001027345.2. [Q8I4B0-5]
NP_001040829.1. NM_001047364.2. [Q8I4B0-6]
NP_001254226.1. NM_001267297.1. [Q8I4B0-7]
NP_496104.2. NM_063703.4. [Q8I4B0-4]
NP_871934.1. NM_182134.3. [Q8I4B0-2]
NP_871935.1. NM_182135.4. [Q8I4B0-1]
NP_871936.1. NM_182136.4. [Q8I4B0-3]
UniGeneiCel.7785.

3D structure databases

ProteinModelPortaliQ8I4B0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi6239.ZK1321.2c.

Protein family/group databases

TCDBi1.A.1.2.20. the voltage-gated ion channel (vic) superfamily.

Proteomic databases

PaxDbiQ8I4B0.
PeptideAtlasiQ8I4B0.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiZK1321.2c; ZK1321.2c; WBGene00014261. [Q8I4B0-1]
GeneIDi174536.
KEGGicel:CELE_ZK1321.2.
UCSCiZK1321.2a. c. elegans.

Organism-specific databases

CTDi174536.
WormBaseiZK1321.2a; CE32769; WBGene00014261; shk-1.
ZK1321.2b; CE32770; WBGene00014261; shk-1.
ZK1321.2c; CE32771; WBGene00014261; shk-1.
ZK1321.2d; CE32772; WBGene00014261; shk-1.
ZK1321.2e; CE36966; WBGene00014261; shk-1.
ZK1321.2f; CE40295; WBGene00014261; shk-1.
ZK1321.2g; CE45447; WBGene00014261; shk-1.

Phylogenomic databases

eggNOGiKOG1545. Eukaryota.
COG1226. LUCA.
GeneTreeiENSGT00760000118846.
HOGENOMiHOG000231015.
InParanoidiQ8I4B0.
KOiK04874.
OMAiDFQEENL.
OrthoDBiEOG091G10NU.
PhylomeDBiQ8I4B0.

Miscellaneous databases

PROiQ8I4B0.

Gene expression databases

BgeeiWBGene00014261.

Family and domain databases

Gene3Di1.20.120.350. 1 hit.
InterProiIPR027359. Channel_four-helix_dom.
IPR005821. Ion_trans_dom.
IPR003968. K_chnl_volt-dep_Kv.
IPR011333. SKP1/BTB/POZ.
IPR003131. T1-type_BTB.
IPR028325. VG_K_chnl.
[Graphical view]
PANTHERiPTHR11537. PTHR11537. 1 hit.
PfamiPF02214. BTB_2. 1 hit.
PF00520. Ion_trans. 1 hit.
[Graphical view]
PRINTSiPR00169. KCHANNEL.
PR01491. KVCHANNEL.
SUPFAMiSSF54695. SSF54695. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiKCNSK_CAEEL
AccessioniPrimary (citable) accession number: Q8I4B0
Secondary accession number(s): E3W725
, Q09658, Q14V33, Q6BEV2, Q8I4A9, Q8I4B1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 9, 2013
Last sequence update: March 1, 2003
Last modified: November 2, 2016
This is version 115 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.