Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable lysine-specific demethylase JMJ14

Gene

JMJ14

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Histone demethylase that demethylates 'Lys-4' (H3K4me) of histone H3 with a higher activity for H3K4me3 and H3K4me2 than H3K4me1. No activity on H3K9me3/2, H3K36me3/2 and H3K27me3/2. Represses FT and TSF expression to inhibit the floral transition. Binds around the transcription start site of the FT locus. Involved in the DRM2-mediated maintenance of DNA methylation, but not required for the de novo DNA methylation. Required for demethylating histone H3K4me3 at the target of RNA silencing.5 Publications

Cofactori

Protein has several cofactor binding sites:
  • 2-oxoglutarate1 Publication
  • Fe2+1 PublicationNote: Binds 1 Fe2+ ion per subunit.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi309Iron; catalyticPROSITE-ProRule annotation1
Metal bindingi311Iron; catalyticPROSITE-ProRule annotation1
Metal bindingi397Iron; catalyticPROSITE-ProRule annotation1

GO - Molecular functioni

  • dioxygenase activity Source: UniProtKB-KW
  • histone demethylase activity (H3-K4 specific) Source: TAIR
  • metal ion binding Source: UniProtKB-KW
  • transcription factor activity, sequence-specific DNA binding Source: TAIR
  • transcription regulatory region sequence-specific DNA binding Source: TAIR

GO - Biological processi

  • histone H3-K4 demethylation Source: CACAO
  • maintenance of DNA methylation Source: TAIR
  • negative regulation of flower development Source: TAIR
  • negative regulation of long-day photoperiodism, flowering Source: CACAO
  • negative regulation of transcription, DNA-templated Source: TAIR
  • photoperiodism, flowering Source: TAIR
  • regulation of transcription, DNA-templated Source: TAIR
  • transcription, DNA-templated Source: UniProtKB-KW

Keywordsi

Molecular functionChromatin regulator, Dioxygenase, Oxidoreductase
Biological processTranscription, Transcription regulation
LigandIron, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Probable lysine-specific demethylase JMJ14 (EC:1.14.11.-)
Alternative name(s):
Jumonji domain-containing protein 14
Jumonji domain-containing protein 4
Lysine-specific histone demethylase JMJ14
Protein JUMONJI 14
Gene namesi
Name:JMJ14
Synonyms:JMJ4, PKDM7B
Ordered Locus Names:At4g20400
ORF Names:F9F13.50
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 4

Organism-specific databases

AraportiAT4G20400.
TAIRilocus:2128659. AT4G20400.

Subcellular locationi

GO - Cellular componenti

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Disruption phenotypei

Early flowering, but normal development of all organs. Partially redundant with ELF6.3 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi387E → K in jmj14-3; loss of transgenic photobleaching phenotype due to RNA silencing. 1 Publication1
Mutagenesisi397H → A: Loss of demethylation activity. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00004126331 – 954Probable lysine-specific demethylase JMJ14Add BLAST954

Proteomic databases

PaxDbiQ8GUI6.
PRIDEiQ8GUI6.

PTM databases

iPTMnetiQ8GUI6.

Expressioni

Tissue specificityi

Expressed in shoot apex, primary root tip, trichomes of young leaves, leaf vascular tissues, anther filaments and styles. Detected in inflorescences, leaves, stems, roots and siliques.3 Publications

Gene expression databases

ExpressionAtlasiQ8GUI6. baseline and differential.
GenevisibleiQ8GUI6. AT.

Interactioni

Protein-protein interaction databases

BioGridi13079. 2 interactors.
IntActiQ8GUI6. 1 interactor.
STRINGi3702.AT4G20400.1.

Structurei

3D structure databases

ProteinModelPortaliQ8GUI6.
SMRiQ8GUI6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini56 – 97JmjNPROSITE-ProRule annotationAdd BLAST42
Domaini263 – 429JmjCPROSITE-ProRule annotationAdd BLAST167
Domaini726 – 784FYR N-terminalPROSITE-ProRule annotationAdd BLAST59
Domaini786 – 876FYR C-terminalPROSITE-ProRule annotationAdd BLAST91

Sequence similaritiesi

Belongs to the JARID1 histone demethylase family.Curated

Phylogenomic databases

eggNOGiKOG1246. Eukaryota.
ENOG410XR9J. LUCA.
HOGENOMiHOG000241335.
InParanoidiQ8GUI6.
KOiK11446.
OMAiHGHESER.
OrthoDBiEOG093600LN.
PhylomeDBiQ8GUI6.

Family and domain databases

InterProiView protein in InterPro
IPR003889. FYrich_C.
IPR003888. FYrich_N.
IPR003347. JmjC_dom.
IPR003349. JmjN.
IPR004198. Znf_C5HC2.
PfamiView protein in Pfam
PF05965. FYRC. 1 hit.
PF05964. FYRN. 1 hit.
PF02373. JmjC. 1 hit.
PF02375. JmjN. 1 hit.
PF02928. zf-C5HC2. 1 hit.
SMARTiView protein in SMART
SM00542. FYRC. 1 hit.
SM00541. FYRN. 1 hit.
SM00558. JmjC. 1 hit.
SM00545. JmjN. 1 hit.
PROSITEiView protein in PROSITE
PS51543. FYRC. 1 hit.
PS51542. FYRN. 1 hit.
PS51184. JMJC. 1 hit.
PS51183. JMJN. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8GUI6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDQLASLAES VAMEEDSEKQ SIKGESSLEP DSTPSSPKIT ARWNPSEACR
60 70 80 90 100
PLVDDAPIFY PTNEDFDDPL GYIEKLRSKA ESYGICRIVP PVAWRPPCPL
110 120 130 140 150
KEKKIWENSK FPTRIQFIDL LQNREPIKKS TKTKKRKRRR ISKIGYTRRK
160 170 180 190 200
RDSGCDTASS GSSDSEGKFG FQTGPDFTLE EFQKYDEYFK ECYFQSEDHP
210 220 230 240 250
GSKASENKKF KPKVKDLEGE YWRIVEQATD EVEVYYGADL ETKKFGSGFP
260 270 280 290 300
KYKPGYPISE ADQYSQCGWN LNNLSRLPGS VLAFESCDIS GVIVPWLYVG
310 320 330 340 350
MCFSTFCWHV EDHHLYSMNY LHTGDPKVWY GIPGNHAESF ENVMKKRLPD
360 370 380 390 400
LFEEQPDLLH QLVTQLSPRI LKEEGVPVYR AVQRSGEFIL TFPKAYHSGF
410 420 430 440 450
NCGFNCAEAV NVAPVDWLVH GQNAVEGYSK QRRKSSLSHD KLLLGAAMEA
460 470 480 490 500
TYCLWELSLS KKKTPVIARW KRVCSEDGLL TKAVKKRVQM EEERLNHLQD
510 520 530 540 550
GFSLRKMEGD FDNKRERECF LCFYDLHMSA SSCKCSPNRF ACLIHAKDLC
560 570 580 590 600
SCESKDRYIL IRHTLDELWA LVRALEGDLD AIDLWASKCR DQYPSQHPRA
610 620 630 640 650
REYAYLKSAP CIKSRGSSKV QQREQNNLQL VSERLQSDLT SNKEVQLKQD
660 670 680 690 700
GDSDVNRHGH ESERNHVHGI TDKSAVTDVK LGVGGKFDEK KISVESQNPH
710 720 730 740 750
SVSDVGCSEL AKKVDGCLGG KDQNAATNRL SLSVELLSSG SLVVKKLWCS
760 770 780 790 800
KQAIYPKGFK SRVKFLSVLD PTNLTNYISE VLDAGLLGPL FRVSVEDYPT
810 820 830 840 850
ENFSNVSAEK CWQMVTQRLK LEIIKKCDQP VSSLTSLQPL ESINGLEMFG
860 870 880 890 900
FLSPHVIKVV EALDPKHQLE EYWNQKAVKL FGAEPIKEGE KDDTEKGGAS
910 920 930 940 950
DPSLDRDTRL LRGLLKKATP EELVMMHGLL CGETRNTELK EELSTLVDKM

EISP
Length:954
Mass (Da):108,156
Last modified:March 1, 2003 - v1
Checksum:i551B17E4D6FF336A
GO
Isoform 2 (identifier: Q8GUI6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-64: MDQLASLAESVAMEEDSEKQSIKGESSLEPDSTPSSPKITARWNPSEACRPLVDDAPIFYPTNE → MILLHGQ

Note: Derived from EST data. No experimental confirmation available.
Show »
Length:897
Mass (Da):101,969
Checksum:i167CE43E2EDFEDE6
GO

Sequence cautioni

The sequence CAB45806 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAB79040 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0417281 – 64MDQLA…YPTNE → MILLHGQ in isoform 2. CuratedAdd BLAST64

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL080253 Genomic DNA. Translation: CAB45806.1. Sequence problems.
AL161553 Genomic DNA. Translation: CAB79040.1. Sequence problems.
CP002687 Genomic DNA. Translation: AEE84324.1.
CP002687 Genomic DNA. Translation: AEE84325.1.
BT002486 mRNA. Translation: AAO00846.1.
BT010548 mRNA. Translation: AAQ65171.1.
PIRiT10582.
RefSeqiNP_001031681.1. NM_001036604.1. [Q8GUI6-2]
NP_193773.2. NM_118159.3. [Q8GUI6-1]
UniGeneiAt.43482.

Genome annotation databases

EnsemblPlantsiAT4G20400.1; AT4G20400.1; AT4G20400. [Q8GUI6-1]
AT4G20400.2; AT4G20400.2; AT4G20400. [Q8GUI6-2]
GeneIDi827788.
GrameneiAT4G20400.1; AT4G20400.1; AT4G20400.
AT4G20400.2; AT4G20400.2; AT4G20400.
KEGGiath:AT4G20400.

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiJMJ14_ARATH
AccessioniPrimary (citable) accession number: Q8GUI6
Secondary accession number(s): F4JUW8, Q9SUN9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 21, 2011
Last sequence update: March 1, 2003
Last modified: August 30, 2017
This is version 108 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families