SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8GUI6

- JMJ14_ARATH

UniProt

Q8GUI6 - JMJ14_ARATH

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Probable lysine-specific demethylase JMJ14
Gene
JMJ14, JMJ4, PKDM7B, At4g20400, F9F13.50
Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Histone demethylase that demethylates 'Lys-4' (H3K4me) of histone H3 with a higher activity for H3K4me3 and H3K4me2 than H3K4me1. No activity on H3K9me3/2, H3K36me3/2 and H3K27me3/2. Represses FT and TSF expression to inhibit the floral transition. Binds around the transcription start site of the FT locus. Involved in the DRM2-mediated maintenance of DNA methylation, but not required for the de novo DNA methylation. Required for demethylating histone H3K4me3 at the target of RNA silencing.5 Publications

Cofactori

Fe2+.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi309 – 3091Iron; catalytic By similarity
Metal bindingi311 – 3111Iron; catalytic By similarity
Metal bindingi397 – 3971Iron; catalytic By similarity

GO - Molecular functioni

  1. dioxygenase activity Source: UniProtKB-KW
  2. histone demethylase activity (H3-K4 specific) Source: TAIR
  3. sequence-specific DNA binding transcription factor activity Source: TAIR

GO - Biological processi

  1. histone H3-K4 demethylation Source: TAIR
  2. maintenance of DNA methylation Source: TAIR
  3. negative regulation of flower development Source: TAIR
  4. photoperiodism, flowering Source: TAIR
  5. regulation of transcription, DNA-templated Source: TAIR
  6. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Chromatin regulator, Dioxygenase, Oxidoreductase

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

Iron, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Probable lysine-specific demethylase JMJ14 (EC:1.14.11.-)
Alternative name(s):
Jumonji domain-containing protein 14
Jumonji domain-containing protein 4
Lysine-specific histone demethylase JMJ14
Protein JUMONJI 14
Gene namesi
Name:JMJ14
Synonyms:JMJ4, PKDM7B
Ordered Locus Names:At4g20400
ORF Names:F9F13.50
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
ProteomesiUP000006548: Chromosome 4

Organism-specific databases

TAIRiAT4G20400.

Subcellular locationi

Nucleusnucleoplasm
Note: Not detected in the nucleolus and the chromocenters.3 Publications

GO - Cellular componenti

  1. nucleoplasm Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Disruption phenotypei

Early flowering, but normal development of all organs. Partially redundant with ELF6.3 Publications

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi387 – 3871E → K in jmj14-3; loss of transgenic photobleaching phenotype due to RNA silencing. 1 Publication
Mutagenesisi397 – 3971H → A: Loss of demethylation activity. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 954954Probable lysine-specific demethylase JMJ14
PRO_0000412633Add
BLAST

Proteomic databases

PaxDbiQ8GUI6.
PRIDEiQ8GUI6.

Expressioni

Tissue specificityi

Expressed in shoot apex, primary root tip, trichomes of young leaves, leaf vascular tissues, anther filaments and styles. Detected in inflorescences, leaves, stems, roots and siliques.3 Publications

Gene expression databases

GenevestigatoriQ8GUI6.

Interactioni

Protein-protein interaction databases

BioGridi13079. 1 interaction.
IntActiQ8GUI6. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ8GUI6.
SMRiQ8GUI6. Positions 41-413.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini56 – 9742JmjN
Add
BLAST
Domaini263 – 429167JmjC
Add
BLAST
Domaini726 – 78459FYR N-terminal
Add
BLAST
Domaini786 – 87691FYR C-terminal
Add
BLAST

Sequence similaritiesi

Contains 1 JmjC domain.
Contains 1 JmjN domain.

Phylogenomic databases

eggNOGiNOG327026.
HOGENOMiHOG000241335.
InParanoidiQ8GUI6.
KOiK11446.
OMAiGHESERN.
PhylomeDBiQ8GUI6.

Family and domain databases

InterProiIPR003889. FYrich_C.
IPR003888. FYrich_N.
IPR003347. JmjC_dom.
IPR003349. TF_JmjN.
IPR004198. Znf_C5HC2.
[Graphical view]
PfamiPF05965. FYRC. 1 hit.
PF05964. FYRN. 1 hit.
PF02373. JmjC. 1 hit.
PF02375. JmjN. 1 hit.
PF02928. zf-C5HC2. 1 hit.
[Graphical view]
SMARTiSM00542. FYRC. 1 hit.
SM00541. FYRN. 1 hit.
SM00558. JmjC. 1 hit.
SM00545. JmjN. 1 hit.
[Graphical view]
PROSITEiPS51543. FYRC. 1 hit.
PS51542. FYRN. 1 hit.
PS51184. JMJC. 1 hit.
PS51183. JMJN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8GUI6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MDQLASLAES VAMEEDSEKQ SIKGESSLEP DSTPSSPKIT ARWNPSEACR    50
PLVDDAPIFY PTNEDFDDPL GYIEKLRSKA ESYGICRIVP PVAWRPPCPL 100
KEKKIWENSK FPTRIQFIDL LQNREPIKKS TKTKKRKRRR ISKIGYTRRK 150
RDSGCDTASS GSSDSEGKFG FQTGPDFTLE EFQKYDEYFK ECYFQSEDHP 200
GSKASENKKF KPKVKDLEGE YWRIVEQATD EVEVYYGADL ETKKFGSGFP 250
KYKPGYPISE ADQYSQCGWN LNNLSRLPGS VLAFESCDIS GVIVPWLYVG 300
MCFSTFCWHV EDHHLYSMNY LHTGDPKVWY GIPGNHAESF ENVMKKRLPD 350
LFEEQPDLLH QLVTQLSPRI LKEEGVPVYR AVQRSGEFIL TFPKAYHSGF 400
NCGFNCAEAV NVAPVDWLVH GQNAVEGYSK QRRKSSLSHD KLLLGAAMEA 450
TYCLWELSLS KKKTPVIARW KRVCSEDGLL TKAVKKRVQM EEERLNHLQD 500
GFSLRKMEGD FDNKRERECF LCFYDLHMSA SSCKCSPNRF ACLIHAKDLC 550
SCESKDRYIL IRHTLDELWA LVRALEGDLD AIDLWASKCR DQYPSQHPRA 600
REYAYLKSAP CIKSRGSSKV QQREQNNLQL VSERLQSDLT SNKEVQLKQD 650
GDSDVNRHGH ESERNHVHGI TDKSAVTDVK LGVGGKFDEK KISVESQNPH 700
SVSDVGCSEL AKKVDGCLGG KDQNAATNRL SLSVELLSSG SLVVKKLWCS 750
KQAIYPKGFK SRVKFLSVLD PTNLTNYISE VLDAGLLGPL FRVSVEDYPT 800
ENFSNVSAEK CWQMVTQRLK LEIIKKCDQP VSSLTSLQPL ESINGLEMFG 850
FLSPHVIKVV EALDPKHQLE EYWNQKAVKL FGAEPIKEGE KDDTEKGGAS 900
DPSLDRDTRL LRGLLKKATP EELVMMHGLL CGETRNTELK EELSTLVDKM 950
EISP 954
Length:954
Mass (Da):108,156
Last modified:March 1, 2003 - v1
Checksum:i551B17E4D6FF336A
GO
Isoform 2 (identifier: Q8GUI6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-64: MDQLASLAESVAMEEDSEKQSIKGESSLEPDSTPSSPKITARWNPSEACRPLVDDAPIFYPTNE → MILLHGQ

Note: Derived from EST data. No experimental confirmation available.

Show »
Length:897
Mass (Da):101,969
Checksum:i167CE43E2EDFEDE6
GO

Sequence cautioni

The sequence CAB45806.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence CAB79040.1 differs from that shown. Reason: Erroneous gene model prediction.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6464MDQLA…YPTNE → MILLHGQ in isoform 2.
VSP_041728Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AL080253 Genomic DNA. Translation: CAB45806.1. Sequence problems.
AL161553 Genomic DNA. Translation: CAB79040.1. Sequence problems.
CP002687 Genomic DNA. Translation: AEE84324.1.
CP002687 Genomic DNA. Translation: AEE84325.1.
BT002486 mRNA. Translation: AAO00846.1.
BT010548 mRNA. Translation: AAQ65171.1.
PIRiT10582.
RefSeqiNP_001031681.1. NM_001036604.1. [Q8GUI6-2]
NP_193773.2. NM_118159.2. [Q8GUI6-1]
UniGeneiAt.43482.

Genome annotation databases

EnsemblPlantsiAT4G20400.1; AT4G20400.1; AT4G20400. [Q8GUI6-1]
GeneIDi827788.
KEGGiath:AT4G20400.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AL080253 Genomic DNA. Translation: CAB45806.1 . Sequence problems.
AL161553 Genomic DNA. Translation: CAB79040.1 . Sequence problems.
CP002687 Genomic DNA. Translation: AEE84324.1 .
CP002687 Genomic DNA. Translation: AEE84325.1 .
BT002486 mRNA. Translation: AAO00846.1 .
BT010548 mRNA. Translation: AAQ65171.1 .
PIRi T10582.
RefSeqi NP_001031681.1. NM_001036604.1. [Q8GUI6-2 ]
NP_193773.2. NM_118159.2. [Q8GUI6-1 ]
UniGenei At.43482.

3D structure databases

ProteinModelPortali Q8GUI6.
SMRi Q8GUI6. Positions 41-413.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 13079. 1 interaction.
IntActi Q8GUI6. 1 interaction.

Proteomic databases

PaxDbi Q8GUI6.
PRIDEi Q8GUI6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblPlantsi AT4G20400.1 ; AT4G20400.1 ; AT4G20400 . [Q8GUI6-1 ]
GeneIDi 827788.
KEGGi ath:AT4G20400.

Organism-specific databases

TAIRi AT4G20400.

Phylogenomic databases

eggNOGi NOG327026.
HOGENOMi HOG000241335.
InParanoidi Q8GUI6.
KOi K11446.
OMAi GHESERN.
PhylomeDBi Q8GUI6.

Gene expression databases

Genevestigatori Q8GUI6.

Family and domain databases

InterProi IPR003889. FYrich_C.
IPR003888. FYrich_N.
IPR003347. JmjC_dom.
IPR003349. TF_JmjN.
IPR004198. Znf_C5HC2.
[Graphical view ]
Pfami PF05965. FYRC. 1 hit.
PF05964. FYRN. 1 hit.
PF02373. JmjC. 1 hit.
PF02375. JmjN. 1 hit.
PF02928. zf-C5HC2. 1 hit.
[Graphical view ]
SMARTi SM00542. FYRC. 1 hit.
SM00541. FYRN. 1 hit.
SM00558. JmjC. 1 hit.
SM00545. JmjN. 1 hit.
[Graphical view ]
PROSITEi PS51543. FYRC. 1 hit.
PS51542. FYRN. 1 hit.
PS51184. JMJC. 1 hit.
PS51183. JMJN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana."
    Mayer K.F.X., Schueller C., Wambutt R., Murphy G., Volckaert G., Pohl T., Duesterhoeft A., Stiekema W., Entian K.-D., Terryn N., Harris B., Ansorge W., Brandt P., Grivell L.A., Rieger M., Weichselgartner M., de Simone V., Obermaier B.
    , Mache R., Mueller M., Kreis M., Delseny M., Puigdomenech P., Watson M., Schmidtheini T., Reichert B., Portetelle D., Perez-Alonso M., Boutry M., Bancroft I., Vos P., Hoheisel J., Zimmermann W., Wedler H., Ridley P., Langham S.-A., McCullagh B., Bilham L., Robben J., van der Schueren J., Grymonprez B., Chuang Y.-J., Vandenbussche F., Braeken M., Weltjens I., Voet M., Bastiaens I., Aert R., Defoor E., Weitzenegger T., Bothe G., Ramsperger U., Hilbert H., Braun M., Holzer E., Brandt A., Peters S., van Staveren M., Dirkse W., Mooijman P., Klein Lankhorst R., Rose M., Hauf J., Koetter P., Berneiser S., Hempel S., Feldpausch M., Lamberth S., Van den Daele H., De Keyser A., Buysshaert C., Gielen J., Villarroel R., De Clercq R., van Montagu M., Rogers J., Cronin A., Quail M.A., Bray-Allen S., Clark L., Doggett J., Hall S., Kay M., Lennard N., McLay K., Mayes R., Pettett A., Rajandream M.A., Lyne M., Benes V., Rechmann S., Borkova D., Bloecker H., Scharfe M., Grimm M., Loehnert T.-H., Dose S., de Haan M., Maarse A.C., Schaefer M., Mueller-Auer S., Gabel C., Fuchs M., Fartmann B., Granderath K., Dauner D., Herzl A., Neumann S., Argiriou A., Vitale D., Liguori R., Piravandi E., Massenet O., Quigley F., Clabauld G., Muendlein A., Felber R., Schnabl S., Hiller R., Schmidt W., Lecharny A., Aubourg S., Chefdor F., Cooke R., Berger C., Monfort A., Casacuberta E., Gibbons T., Weber N., Vandenbol M., Bargues M., Terol J., Torres A., Perez-Perez A., Purnelle B., Bent E., Johnson S., Tacon D., Jesse T., Heijnen L., Schwarz S., Scholler P., Heber S., Francs P., Bielke C., Frishman D., Haase D., Lemcke K., Mewes H.-W., Stocker S., Zaccaria P., Bevan M., Wilson R.K., de la Bastide M., Habermann K., Parnell L., Dedhia N., Gnoj L., Schutz K., Huang E., Spiegel L., Sekhon M., Murray J., Sheet P., Cordes M., Abu-Threideh J., Stoneking T., Kalicki J., Graves T., Harmon G., Edwards J., Latreille P., Courtney L., Cloud J., Abbott A., Scott K., Johnson D., Minx P., Bentley D., Fulton B., Miller N., Greco T., Kemp K., Kramer J., Fulton L., Mardis E., Dante M., Pepin K., Hillier L.W., Nelson J., Spieth J., Ryan E., Andrews S., Geisel C., Layman D., Du H., Ali J., Berghoff A., Jones K., Drone K., Cotton M., Joshu C., Antonoiu B., Zidanic M., Strong C., Sun H., Lamar B., Yordan C., Ma P., Zhong J., Preston R., Vil D., Shekher M., Matero A., Shah R., Swaby I.K., O'Shaughnessy A., Rodriguez M., Hoffman J., Till S., Granat S., Shohdy N., Hasegawa A., Hameed A., Lodhi M., Johnson A., Chen E., Marra M.A., Martienssen R., McCombie W.R.
    Nature 402:769-777(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: cv. Columbia.
  2. The Arabidopsis Information Resource (TAIR)
    Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
    Cited for: GENOME REANNOTATION.
    Strain: cv. Columbia.
  3. "Empirical analysis of transcriptional activity in the Arabidopsis genome."
    Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G.
    , Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J., Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y., Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P., Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F., Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M., Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J., Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T., Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y., Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.
    Science 302:842-846(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: cv. Columbia.
  4. "Evolutionary history of histone demethylase families: distinct evolutionary patterns suggest functional divergence."
    Zhou X., Ma H.
    BMC Evol. Biol. 8:294-294(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: GENE FAMILY, NOMENCLATURE.
  5. "Comparative analysis of JmjC domain-containing proteins reveals the potential histone demethylases in Arabidopsis and rice."
    Lu F., Li G., Cui X., Liu C., Wang X.J., Cao X.
    J. Integr. Plant Biol. 50:886-896(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: GENE FAMILY, NOMENCLATURE, TISSUE SPECIFICITY.
  6. "Repression of FLOWERING LOCUS T chromatin by functionally redundant histone H3 lysine 4 demethylases in Arabidopsis."
    Jeong J.H., Song H.R., Ko J.H., Jeong Y.M., Kwon Y.E., Seol J.H., Amasino R.M., Noh B., Noh Y.S.
    PLoS ONE 4:E8033-E8033(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, DISRUPTION PHENOTYPE, TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
  7. "JMJ14 is an H3K4 demethylase regulating flowering time in Arabidopsis."
    Lu F., Cui X., Zhang S., Liu C., Cao X.
    Cell Res. 20:387-390(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, MUTAGENESIS OF HIS-397, SUBCELLULAR LOCATION, DISRUPTION PHENOTYPE.
  8. "Involvement of a Jumonji-C domain-containing histone demethylase in DRM2-mediated maintenance of DNA methylation."
    Deleris A., Greenberg M.V., Ausin I., Law R.W., Moissiard G., Schubert D., Jacobsen S.E.
    EMBO Rep. 11:950-955(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION.
  9. "JMJ14, a JmjC domain protein, is required for RNA silencing and cell-to-cell movement of an RNA silencing signal in Arabidopsis."
    Searle I.R., Pontes O., Melnyk C.W., Smith L.M., Baulcombe D.C.
    Genes Dev. 24:986-991(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, MUTAGENESIS OF GLU-387.
  10. "A plant-specific histone H3 lysine 4 demethylase represses the floral transition in Arabidopsis."
    Yang W., Jiang D., Jiang J., He Y.
    Plant J. 62:663-673(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, DISRUPTION PHENOTYPE, TISSUE SPECIFICITY, COFACTOR.

Entry informationi

Entry nameiJMJ14_ARATH
AccessioniPrimary (citable) accession number: Q8GUI6
Secondary accession number(s): F4JUW8, Q9SUN9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 21, 2011
Last sequence update: March 1, 2003
Last modified: September 3, 2014
This is version 87 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi