Q8GUI6 (JMJ14_ARATH) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 75.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Probable lysine-specific demethylase JMJ14 EC=1.14.11.- Alternative name(s): Jumonji domain-containing protein 14 Jumonji domain-containing protein 4 Lysine-specific histone demethylase JMJ14 Protein JUMONJI 14 | ||||||||
| Gene names |
| ||||||||
| Organism | Arabidopsis thaliana (Mouse-ear cress) [Reference proteome] | ||||||||
| Taxonomic identifier | 3702 [NCBI] | ||||||||
| Taxonomic lineage | Eukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliophyta › eudicotyledons › core eudicotyledons › rosids › malvids › Brassicales › Brassicaceae › Camelineae › Arabidopsis![]() |
Protein attributes
| Sequence length | 954 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Histone demethylase that demethylates 'Lys-4' (H3K4me) of histone H3 with a higher activity for H3K4me3 and H3K4me2 than H3K4me1. No activity on H3K9me3/2, H3K36me3/2 and H3K27me3/2. Represses FT and TSF expression to inhibit the floral transition. Binds around the transcription start site of the FT locus. Involved in the DRM2-mediated maintenance of DNA methylation, but not required for the de novo DNA methylation. Required for demethylating histone H3K4me3 at the target of RNA silencing. Ref.6 Ref.7 Ref.8 Ref.9 Ref.10 |
| Cofactor | Fe2+. Ref.10 |
| Subcellular location | Nucleus › nucleoplasm. Note: Not detected in the nucleolus and the chromocenters. Ref.6 Ref.7 Ref.8 |
| Tissue specificity | Expressed in shoot apex, primary root tip, trichomes of young leaves, leaf vascular tissues, anther filaments and styles. Detected in inflorescences, leaves, stems, roots and siliques. Ref.5 Ref.6 Ref.10 |
| Disruption phenotype | Early flowering, but normal development of all organs. Partially redundant with ELF6. Ref.6 Ref.7 Ref.10 |
| Sequence similarities | Belongs to the JARID1 histone demethylase family. Contains 1 FYR C-terminal domain. Contains 1 FYR N-terminal domain. Contains 1 JmjC domain. Contains 1 JmjN domain. |
| Sequence caution | The sequence CAB45806.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAB79040.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8GUI6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8GUI6-2) The sequence of this isoform differs from the canonical sequence as follows: 1-64: MDQLASLAESVAMEEDSEKQSIKGESSLEPDSTPSSPKITARWNPSEACRPLVDDAPIFYPTNE → MILLHGQ | ||||||
| Note: Derived from EST data. No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 954 | 954 | Probable lysine-specific demethylase JMJ14 | PRO_0000412633 | |||||
Regions | |||||||||
| Domain | 56 – 97 | 42 | JmjN | ||||||
| Domain | 263 – 429 | 167 | JmjC | ||||||
| Domain | 726 – 784 | 59 | FYR N-terminal | ||||||
| Domain | 786 – 876 | 91 | FYR C-terminal | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 64 | 64 | MDQLA…YPTNE → MILLHGQ in isoform 2. | VSP_041728 | |||||
Experimental info | |||||||||
| Mutagenesis | 387 | 1 | E → K in jmj14-3; loss of transgenic photobleaching phenotype due to RNA silencing. Ref.9 | ||||||
| Mutagenesis | 397 | 1 | H → A: Loss of demethylation activity. Ref.7 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana." Mayer K.F.X., Schueller C., Wambutt R., Murphy G., Volckaert G., Pohl T., Duesterhoeft A., Stiekema W., Entian K.-D., Terryn N., Harris B., Ansorge W., Brandt P., Grivell L.A., Rieger M., Weichselgartner M., de Simone V., Obermaier B. McCombie W.R.Nature 402:769-777(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: cv. Columbia. |
| [2] | The Arabidopsis Information Resource (TAIR) Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases Cited for: GENOME REANNOTATION. Strain: cv. Columbia. |
| [3] | "Empirical analysis of transcriptional activity in the Arabidopsis genome." Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G. Ecker J.R.Science 302:842-846(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: cv. Columbia. |
| [4] | "Evolutionary history of histone demethylase families: distinct evolutionary patterns suggest functional divergence." Zhou X., Ma H. BMC Evol. Biol. 8:294-294(2008) [PubMed] [Europe PMC] [Abstract] Cited for: GENE FAMILY, NOMENCLATURE. |
| [5] | "Comparative analysis of JmjC domain-containing proteins reveals the potential histone demethylases in Arabidopsis and rice." Lu F., Li G., Cui X., Liu C., Wang X.J., Cao X. J. Integr. Plant Biol. 50:886-896(2008) [PubMed] [Europe PMC] [Abstract] Cited for: GENE FAMILY, NOMENCLATURE, TISSUE SPECIFICITY. |
| [6] | "Repression of FLOWERING LOCUS T chromatin by functionally redundant histone H3 lysine 4 demethylases in Arabidopsis." Jeong J.H., Song H.R., Ko J.H., Jeong Y.M., Kwon Y.E., Seol J.H., Amasino R.M., Noh B., Noh Y.S. PLoS ONE 4:E8033-E8033(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DISRUPTION PHENOTYPE, TISSUE SPECIFICITY, SUBCELLULAR LOCATION. |
| [7] | "JMJ14 is an H3K4 demethylase regulating flowering time in Arabidopsis." Lu F., Cui X., Zhang S., Liu C., Cao X. Cell Res. 20:387-390(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF HIS-397, SUBCELLULAR LOCATION, DISRUPTION PHENOTYPE. |
| [8] | "Involvement of a Jumonji-C domain-containing histone demethylase in DRM2-mediated maintenance of DNA methylation." Deleris A., Greenberg M.V., Ausin I., Law R.W., Moissiard G., Schubert D., Jacobsen S.E. EMBO Rep. 11:950-955(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [9] | "JMJ14, a JmjC domain protein, is required for RNA silencing and cell-to-cell movement of an RNA silencing signal in Arabidopsis." Searle I.R., Pontes O., Melnyk C.W., Smith L.M., Baulcombe D.C. Genes Dev. 24:986-991(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF GLU-387. |
| [10] | "A plant-specific histone H3 lysine 4 demethylase represses the floral transition in Arabidopsis." Yang W., Jiang D., Jiang J., He Y. Plant J. 62:663-673(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DISRUPTION PHENOTYPE, TISSUE SPECIFICITY, COFACTOR. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AL080253 Genomic DNA. Translation: CAB45806.1. Sequence problems. AL161553 Genomic DNA. Translation: CAB79040.1. Sequence problems. CP002687 Genomic DNA. Translation: AEE84324.1. CP002687 Genomic DNA. Translation: AEE84325.1. BT002486 mRNA. Translation: AAO00846.1. BT010548 mRNA. Translation: AAQ65171.1. |
| IPI | IPI00516310. IPI00656704. |
| PIR | T10582. |
| RefSeq | NP_001031681.1. NM_001036604.1. NP_193773.2. NM_118159.2. |
| UniGene | At.43482. |
3D structure databases | |
| ProteinModelPortal | Q8GUI6. |
| SMR | Q8GUI6. Positions 59-425. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8GUI6. 1 interaction. |
Proteomic databases | |
| PaxDb | Q8GUI6. |
| PRIDE | Q8GUI6. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblPlants | AT4G20400.1; AT4G20400.1; AT4G20400. |
| GeneID | 827788. |
| KEGG | ath:AT4G20400. |
Organism-specific databases | |
| TAIR | At4g20400. |
Phylogenomic databases | |
| eggNOG | NOG327026. |
| HOGENOM | HOG000241335. |
| InParanoid | Q8GUI6. |
| KO | K11446. |
| OMA | VQRSGEF. |
| PhylomeDB | Q8GUI6. |
| ProtClustDB | CLSN2679960. |
Gene expression databases | |
| ArrayExpress | Q8GUI6. |
| Genevestigator | Q8GUI6. |
Family and domain databases | |
| InterPro | IPR003889. FYrich_C. IPR003888. FYrich_N. IPR003347. JmjC_dom. IPR003349. TF_JmjN. IPR004198. Znf_C5HC2. [Graphical view] |
| Pfam | PF05965. FYRC. 1 hit. PF05964. FYRN. 1 hit. PF02373. JmjC. 1 hit. PF02375. JmjN. 1 hit. PF02928. zf-C5HC2. 1 hit. [Graphical view] |
| SMART | SM00542. FYRC. 1 hit. SM00541. FYRN. 1 hit. SM00558. JmjC. 1 hit. SM00545. JmjN. 1 hit. [Graphical view] |
| PROSITE | PS51543. FYRC. 1 hit. PS51542. FYRN. 1 hit. PS51184. JMJC. 1 hit. PS51183. JMJN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | JMJ14_ARATH | ||||||||
| Accession | Primary (citable) accession number: Q8GUI6 Secondary accession number(s): F4JUW8, Q9SUN9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Plant Protein Annotation Program | ||||||||
Relevant documents
| Arabidopsis thaliana Arabidopsis thaliana: entries and gene names |
| SIMILARITY comments Index of protein domains and families |

Clusters with
