Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Double-stranded RNA-binding protein Staufen homolog 2

Gene

Stau2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

RNA-binding protein required for the microtubule-dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from the cell body (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transport

Keywords - Ligandi

RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Double-stranded RNA-binding protein Staufen homolog 2
Gene namesi
Name:Stau2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 1

Organism-specific databases

MGIiMGI:1352508. Stau2.

Subcellular locationi

  • Cytoplasm 1 Publication
  • Nucleus 1 Publication
  • Nucleusnucleolus 1 Publication
  • Endoplasmic reticulum 1 Publication

  • Note: Shuttles between the nucleolus, nucleus and the cytoplasm. Nuclear export of isoform 1 is independent of XPO1/CRM1 and requires the exportin XPO5. Nuclear export of isoform 2 and isoform 3 can occur by both XPO1/CRM1-dependent and XPO1/CRM1-independent pathways. May also be found in large cytoplasmic ribonucleoprotein (RNP) granules which are present in the actin rich regions of myelinating processes and associated with microtubules, polysomes and the endoplasmic reticulum. Also recruited to stress granules (SGs) upon inhibition of translation or oxidative stress. These structures are thought to harbor housekeeping mRNAs when translation is aborted.

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum, Microtubule, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi235H → A: Abrogates RNA-binding by DRBM 3 and interaction with XPO5 and nuclear export; when associated with A-237. 1 Publication1
Mutagenesisi237K → A: Abrogates RNA-binding by DRBM 3 and interaction with XPO5 and nuclear export; when associated with A-235. 1 Publication1
Mutagenesisi273 – 274KK → AA: Prevents nuclear localization of mutants lacking DRBM 3 function; when associated with 289-AAA-291. 1 Publication2
Mutagenesisi289 – 291KKR → AAA: Prevents nuclear localization of mutants lacking DRBM 3 function; when associated with 257-AA-258. 1 Publication3

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000722471 – 570Double-stranded RNA-binding protein Staufen homolog 2Add BLAST570

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei188PhosphoserineBy similarity1
Modified residuei395PhosphoserineBy similarity1
Modified residuei405PhosphothreonineBy similarity1
Modified residuei416PhosphoserineBy similarity1
Modified residuei426PhosphoserineBy similarity1
Modified residuei440PhosphoserineBy similarity1
Modified residuei455PhosphoserineBy similarity1
Modified residuei492PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8CJ67.
PeptideAtlasiQ8CJ67.
PRIDEiQ8CJ67.

PTM databases

iPTMnetiQ8CJ67.
PhosphoSitePlusiQ8CJ67.

Expressioni

Tissue specificityi

Expressed in brain and neurons, where isoform 2 and isoform 3 appear to be the most abundant. Expressed at the neuromuscular junction of the extensor digitorum longus, tibialis anterior and soleus muscles. Expression at neuromuscular junctions is most pronounced in slow-twitch muscle. Also weakly expressed in heart, kidney, ovary and testis.2 Publications

Inductioni

Expression in extrasynaptic regions of muscle is induced by denervation. Expression in myoblasts is induced during differentiation into myotubes and by treatment with nerve derived trophic factors such as AGRN (agrin) and NRG1 (neuregulin).1 Publication

Gene expression databases

BgeeiENSMUSG00000025920.
ExpressionAtlasiQ8CJ67. baseline and differential.
GenevisibleiQ8CJ67. MM.

Interactioni

Subunit structurei

Interacts with microtubules. Isoform 2 and isoform 3 may also interact with ribosomes, and this association is independent of translation (By similarity). Identified in a mRNP complex, at least composed of DHX9, DDX3X, ELAVL1, HNRNPU, IGF2BP1, ILF3, PABPC1, PCBP2, PTBP2, STAU1, STAU2, SYNCRIP and YBX1. Interacts with the exportin XPO5. This requires RNA and RAN bound to GTP.By similarity1 Publication

Protein-protein interaction databases

MINTiMINT-243177.
STRINGi10090.ENSMUSP00000053190.

Structurei

Secondary structure

1570
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi308 – 318Combined sources11
Beta strandi325 – 333Combined sources9
Beta strandi339 – 346Combined sources8
Beta strandi349 – 357Combined sources9
Helixi358 – 373Combined sources16
Helixi377 – 383Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1UHZNMR-A308-383[»]
ProteinModelPortaliQ8CJ67.
SMRiQ8CJ67.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8CJ67.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini8 – 75DRBM 1PROSITE-ProRule annotationAdd BLAST68
Domaini95 – 181DRBM 2PROSITE-ProRule annotationAdd BLAST87
Domaini207 – 274DRBM 3PROSITE-ProRule annotationAdd BLAST68
Domaini307 – 375DRBM 4PROSITE-ProRule annotationAdd BLAST69

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni381 – 570Required for dendritic transportBy similarityAdd BLAST190

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi273 – 291Nuclear localization signal 1Add BLAST19
Motifi373 – 412Nuclear localization signal 2By similarityAdd BLAST40

Domaini

The DRBM 3 domain appears to be the major RNA-binding determinant. This domain also mediates interaction with XPO5 and is required for XPO1/CRM1-independent nuclear export.2 Publications

Sequence similaritiesi

Contains 4 DRBM (double-stranded RNA-binding) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG3732. Eukaryota.
ENOG410XSCK. LUCA.
GeneTreeiENSGT00830000128290.
HOGENOMiHOG000231025.
HOVERGENiHBG005013.
InParanoidiQ8CJ67.
KOiK17597.
OMAiDNMANPK.
OrthoDBiEOG091G07A0.
PhylomeDBiQ8CJ67.
TreeFamiTF350296.

Family and domain databases

Gene3Di3.30.160.20. 4 hits.
InterProiIPR014720. dsRBD_dom.
IPR032478. Staufen_C.
[Graphical view]
PfamiPF00035. dsrm. 4 hits.
PF16482. Staufen_C. 1 hit.
[Graphical view]
SMARTiSM00358. DSRM. 4 hits.
[Graphical view]
PROSITEiPS50137. DS_RBD. 4 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8CJ67-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MANPKEKTPV CLVNELARFH SIQPQYKLLN ESGPAHSKMF SVQLSLGEQT
60 70 80 90 100
WESEGSSIKK AQQAVANKAL TESTLPKPVQ KPPKSNVNNN PGSITPTVEL
110 120 130 140 150
NGLAMKRGEP AIYRPLDPKP FPNYRANYNF RGMYNQRYHC PMPKIFYVQL
160 170 180 190 200
TVGNNEFFGE GKTRQAARHN AAMKALQALQ NEPIPEKSPQ NGESGKEMDD
210 220 230 240 250
DKDANKSEIS LVFEIALKRN MPVSFEVIKE SGPPHMKSFV TRVSVGEFSA
260 270 280 290 300
EGEGNSKKLS KKRAATTVLQ ELKKLPPLPV VEKPKLFFKK RPKTIVKAGP
310 320 330 340 350
DYGQGMNPIS RLAQIQQARK EKEPDYILLS ERGMPRRREF VMQVKVGNEV
360 370 380 390 400
ATGTGPNKKI AKKNAAEAML LQLGYKASTS LQDPLDKTGE NKGWSGPKPG
410 420 430 440 450
FPEPTNNTPK GILHLSPDVY QEMEASRHRV TSGTTLSYLS PKDMNQPSSS
460 470 480 490 500
FFSVSPSSTS SATVARELLM NGTSPTAEAI GLKGSSPTSP CSSVQPSKQL
510 520 530 540 550
EYLARIQGFQ AALSALKQFS EQGLESIDGA VNVEKGSLEK QAKHLREKAD
560 570
NNQAKPASIS QDCKKSKSAI
Length:570
Mass (Da):62,535
Last modified:March 1, 2003 - v1
Checksum:i3D7F2DA66B0B8D57
GO
Isoform 2 (identifier: Q8CJ67-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: Missing.
     33-38: GPAHSK → MLQINQ

Show »
Length:538
Mass (Da):59,004
Checksum:i6D746ED7D2A50F93
GO
Isoform 3 (identifier: Q8CJ67-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: Missing.
     33-38: GPAHSK → MLQINQ
     511-511: A → V
     512-570: Missing.

Show »
Length:479
Mass (Da):52,724
Checksum:iFBADDEACE1F3E8EF
GO
Isoform 4 (identifier: Q8CJ67-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-305: Missing.
     511-511: A → V
     512-570: Missing.

Note: No experimental confirmation available.
Show »
Length:206
Mass (Da):22,340
Checksum:i05E34194CA94AB03
GO
Isoform 5 (identifier: Q8CJ67-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     92-125: GSITPTVELNGLAMKRGEPAIYRPLDPKPFPNYR → VGKLKETVLSPAHEVMIVGITHYSADNFFLHWCL
     126-570: Missing.

Show »
Length:125
Mass (Da):13,836
Checksum:i8D678D8578C536E1
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0153781 – 305Missing in isoform 4. 1 PublicationAdd BLAST305
Alternative sequenceiVSP_0153791 – 32Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST32
Alternative sequenceiVSP_01538033 – 38GPAHSK → MLQINQ in isoform 2 and isoform 3. 2 Publications6
Alternative sequenceiVSP_01538192 – 125GSITP…FPNYR → VGKLKETVLSPAHEVMIVGI THYSADNFFLHWCL in isoform 5. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_015382126 – 570Missing in isoform 5. 1 PublicationAdd BLAST445
Alternative sequenceiVSP_015383511A → V in isoform 3 and isoform 4. 2 Publications1
Alternative sequenceiVSP_015384512 – 570Missing in isoform 3 and isoform 4. 2 PublicationsAdd BLAST59

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF459099 mRNA. Translation: AAN37928.1.
AF459100 mRNA. Translation: AAN37929.1.
AK015087 mRNA. Translation: BAB29708.1.
AK028390 mRNA. Translation: BAC25926.1.
BC010300 mRNA. Translation: AAH10300.1.
BC025118 mRNA. Translation: AAH25118.1.
CCDSiCCDS14831.2. [Q8CJ67-1]
CCDS48223.1. [Q8CJ67-2]
RefSeqiNP_001104742.1. NM_001111272.1. [Q8CJ67-2]
NP_079579.2. NM_025303.3. [Q8CJ67-1]
XP_006495591.1. XM_006495528.3. [Q8CJ67-1]
XP_006495595.1. XM_006495532.3. [Q8CJ67-2]
XP_011236689.1. XM_011238387.1. [Q8CJ67-1]
XP_011236691.1. XM_011238389.1. [Q8CJ67-2]
XP_011236693.1. XM_011238391.2. [Q8CJ67-3]
XP_017176591.1. XM_017321102.1. [Q8CJ67-1]
UniGeneiMm.216257.

Genome annotation databases

EnsembliENSMUST00000027052; ENSMUSP00000027052; ENSMUSG00000025920. [Q8CJ67-2]
ENSMUST00000054668; ENSMUSP00000053190; ENSMUSG00000025920. [Q8CJ67-1]
ENSMUST00000115359; ENSMUSP00000111016; ENSMUSG00000025920. [Q8CJ67-5]
ENSMUST00000144138; ENSMUSP00000119130; ENSMUSG00000025920. [Q8CJ67-5]
ENSMUST00000159558; ENSMUSP00000125726; ENSMUSG00000025920. [Q8CJ67-3]
ENSMUST00000162007; ENSMUSP00000124303; ENSMUSG00000025920. [Q8CJ67-3]
ENSMUST00000162435; ENSMUSP00000123827; ENSMUSG00000025920. [Q8CJ67-2]
ENSMUST00000162627; ENSMUSP00000123781; ENSMUSG00000025920. [Q8CJ67-2]
ENSMUST00000162751; ENSMUSP00000124505; ENSMUSG00000025920. [Q8CJ67-1]
GeneIDi29819.
KEGGimmu:29819.
UCSCiuc007ajn.2. mouse. [Q8CJ67-1]
uc007ajo.2. mouse. [Q8CJ67-2]
uc007ajq.2. mouse. [Q8CJ67-3]
uc007ajr.2. mouse. [Q8CJ67-5]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF459099 mRNA. Translation: AAN37928.1.
AF459100 mRNA. Translation: AAN37929.1.
AK015087 mRNA. Translation: BAB29708.1.
AK028390 mRNA. Translation: BAC25926.1.
BC010300 mRNA. Translation: AAH10300.1.
BC025118 mRNA. Translation: AAH25118.1.
CCDSiCCDS14831.2. [Q8CJ67-1]
CCDS48223.1. [Q8CJ67-2]
RefSeqiNP_001104742.1. NM_001111272.1. [Q8CJ67-2]
NP_079579.2. NM_025303.3. [Q8CJ67-1]
XP_006495591.1. XM_006495528.3. [Q8CJ67-1]
XP_006495595.1. XM_006495532.3. [Q8CJ67-2]
XP_011236689.1. XM_011238387.1. [Q8CJ67-1]
XP_011236691.1. XM_011238389.1. [Q8CJ67-2]
XP_011236693.1. XM_011238391.2. [Q8CJ67-3]
XP_017176591.1. XM_017321102.1. [Q8CJ67-1]
UniGeneiMm.216257.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1UHZNMR-A308-383[»]
ProteinModelPortaliQ8CJ67.
SMRiQ8CJ67.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

MINTiMINT-243177.
STRINGi10090.ENSMUSP00000053190.

PTM databases

iPTMnetiQ8CJ67.
PhosphoSitePlusiQ8CJ67.

Proteomic databases

PaxDbiQ8CJ67.
PeptideAtlasiQ8CJ67.
PRIDEiQ8CJ67.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000027052; ENSMUSP00000027052; ENSMUSG00000025920. [Q8CJ67-2]
ENSMUST00000054668; ENSMUSP00000053190; ENSMUSG00000025920. [Q8CJ67-1]
ENSMUST00000115359; ENSMUSP00000111016; ENSMUSG00000025920. [Q8CJ67-5]
ENSMUST00000144138; ENSMUSP00000119130; ENSMUSG00000025920. [Q8CJ67-5]
ENSMUST00000159558; ENSMUSP00000125726; ENSMUSG00000025920. [Q8CJ67-3]
ENSMUST00000162007; ENSMUSP00000124303; ENSMUSG00000025920. [Q8CJ67-3]
ENSMUST00000162435; ENSMUSP00000123827; ENSMUSG00000025920. [Q8CJ67-2]
ENSMUST00000162627; ENSMUSP00000123781; ENSMUSG00000025920. [Q8CJ67-2]
ENSMUST00000162751; ENSMUSP00000124505; ENSMUSG00000025920. [Q8CJ67-1]
GeneIDi29819.
KEGGimmu:29819.
UCSCiuc007ajn.2. mouse. [Q8CJ67-1]
uc007ajo.2. mouse. [Q8CJ67-2]
uc007ajq.2. mouse. [Q8CJ67-3]
uc007ajr.2. mouse. [Q8CJ67-5]

Organism-specific databases

CTDi27067.
MGIiMGI:1352508. Stau2.

Phylogenomic databases

eggNOGiKOG3732. Eukaryota.
ENOG410XSCK. LUCA.
GeneTreeiENSGT00830000128290.
HOGENOMiHOG000231025.
HOVERGENiHBG005013.
InParanoidiQ8CJ67.
KOiK17597.
OMAiDNMANPK.
OrthoDBiEOG091G07A0.
PhylomeDBiQ8CJ67.
TreeFamiTF350296.

Miscellaneous databases

ChiTaRSiStau2. mouse.
EvolutionaryTraceiQ8CJ67.
PROiQ8CJ67.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000025920.
ExpressionAtlasiQ8CJ67. baseline and differential.
GenevisibleiQ8CJ67. MM.

Family and domain databases

Gene3Di3.30.160.20. 4 hits.
InterProiIPR014720. dsRBD_dom.
IPR032478. Staufen_C.
[Graphical view]
PfamiPF00035. dsrm. 4 hits.
PF16482. Staufen_C. 1 hit.
[Graphical view]
SMARTiSM00358. DSRM. 4 hits.
[Graphical view]
PROSITEiPS50137. DS_RBD. 4 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSTAU2_MOUSE
AccessioniPrimary (citable) accession number: Q8CJ67
Secondary accession number(s): Q8BSY8
, Q8CJ66, Q8R175, Q91Z19, Q9D5N7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 30, 2005
Last sequence update: March 1, 2003
Last modified: November 2, 2016
This is version 119 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.