Q8CJ67 (STAU2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
November 16, 2011.
Version 78.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Double-stranded RNA-binding protein Staufen homolog 2 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 570 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | RNA-binding protein required for the microtubule-dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from the cell body By similarity. |
| Subunit structure | Interacts with microtubules. Isoform 2 and isoform 3 may also interact with ribosomes, and this association is independent of translation By similarity. Identified in a mRNP complex, at least composed of DHX9, DDX3X, ELAVL1, HNRNPU, IGF2BP1, ILF3, PABPC1, PCBP2, PTBP2, STAU1, STAU2, SYNCRIP and YBX1. Interacts with the exportin XPO5. This requires RNA and RAN bound to GTP. Ref.5 |
| Subcellular location | Cytoplasm. Nucleus. Nucleus › nucleolus. Endoplasmic reticulum. Note: Shuttles between the nucleolus, nucleus and the cytoplasm. Nuclear export of isoform 1 is independent of XPO1/CRM1 and requires the exportin XPO5. Nuclear export of isoform 2 and isoform 3 can occur by both XPO1/CRM1-dependent and XPO1/CRM1-independent pathways. May also be found in large cytoplasmic ribonucleoprotein (RNP) granules which are present in the actin rich regions of myelinating processes and associated with microtubules, polysomes and the endoplasmic reticulum. Also recruited to stress granules (SGs) upon inhibition of translation or oxidative stress. These structures are thought to harbor housekeeping mRNAs when translation is aborted. Ref.5 |
| Tissue specificity | Expressed in brain and neurons, where isoform 2 and isoform 3 appear to be the most abundant. Expressed at the neuromuscular junction of the extensor digitorum longus, tibialis anterior and soleus muscles. Expression at neuromuscular junctions is most pronounced in slow-twitch muscle. Also weakly expressed in heart, kidney, ovary and testis. Ref.1 Ref.4 |
| Induction | Expression in extrasynaptic regions of muscle is induced by denervation. Expression in myoblasts is induced during differentiation into myotubes and by treatment with nerve derived trophic factors such as AGRN (agrin) and NRG1 (neuregulin). Ref.4 |
| Domain | The DRBM 3 domain appears to be the major RNA-binding determinant. This domain also mediates interaction with XPO5 and is required for XPO1/CRM1-independent nuclear export. Ref.1 Ref.5 |
| Sequence similarities | Contains 4 DRBM (double-stranded RNA-binding) domains. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transport |
| Cellular component | Cytoplasm Endoplasmic reticulum Microtubule Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat |
| Ligand | RNA-binding |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | transport Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | endoplasmic reticulum Inferred from electronic annotation. Source: UniProtKB-SubCell microtubuleInferred from electronic annotation. Source: UniProtKB-KW nucleolusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | double-stranded RNA binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8CJ67-1) Also known as: Long; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8CJ67-2) Also known as: Short; The sequence of this isoform differs from the canonical sequence as follows: 1-32: Missing. 33-38: GPAHSK → MLQINQ | ||||||
| Isoform 3 (identifier: Q8CJ67-3) The sequence of this isoform differs from the canonical sequence as follows: 1-32: Missing. 33-38: GPAHSK → MLQINQ 511-511: A → V 512-570: Missing. | ||||||
| Isoform 4 (identifier: Q8CJ67-4) The sequence of this isoform differs from the canonical sequence as follows: 1-305: Missing. 511-511: A → V 512-570: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q8CJ67-5) The sequence of this isoform differs from the canonical sequence as follows: 92-125: GSITPTVELNGLAMKRGEPAIYRPLDPKPFPNYR → VGKLKETVLSPAHEVMIVGITHYSADNFFLHWCL 126-570: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||
Molecule processing | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 570 | 570 | Double-stranded RNA-binding protein Staufen homolog 2 | PRO_0000072247 | ||||||||||||||
Regions | ||||||||||||||||||
| Domain | 8 – 75 | 68 | DRBM 1 | |||||||||||||||
| Domain | 95 – 181 | 87 | DRBM 2 | |||||||||||||||
| Domain | 207 – 274 | 68 | DRBM 3 | |||||||||||||||
| Domain | 307 – 375 | 69 | DRBM 4 | |||||||||||||||
| Region | 381 – 570 | 190 | Required for dendritic transport By similarity | |||||||||||||||
| Motif | 273 – 291 | 19 | Nuclear localization signal 1 Ref.5 | |||||||||||||||
| Motif | 373 – 412 | 40 | Nuclear localization signal 2 By similarity | |||||||||||||||
Amino acid modifications | ||||||||||||||||||
| Modified residue | 188 | 1 | Phosphoserine By similarity | |||||||||||||||
| Modified residue | 416 | 1 | Phosphoserine By similarity | |||||||||||||||
| Modified residue | 440 | 1 | Phosphoserine By similarity | |||||||||||||||
| Modified residue | 455 | 1 | Phosphoserine By similarity | |||||||||||||||
| Modified residue | 485 | 1 | Phosphoserine By similarity | |||||||||||||||
| Modified residue | 486 | 1 | Phosphoserine By similarity | |||||||||||||||
| Modified residue | 488 | 1 | Phosphothreonine By similarity | |||||||||||||||
| Modified residue | 492 | 1 | Phosphoserine By similarity | |||||||||||||||
Natural variations | ||||||||||||||||||
| Alternative sequence | 1 – 305 | 305 | Missing in isoform 4. | VSP_015378 | ||||||||||||||
| Alternative sequence | 1 – 32 | 32 | Missing in isoform 2 and isoform 3. | VSP_015379 | ||||||||||||||
| Alternative sequence | 33 – 38 | 6 | GPAHSK → MLQINQ in isoform 2 and isoform 3. | VSP_015380 | ||||||||||||||
| Alternative sequence | 92 – 125 | 34 | GSITP…FPNYR → VGKLKETVLSPAHEVMIVGI THYSADNFFLHWCL in isoform 5. | VSP_015381 | ||||||||||||||
| Alternative sequence | 126 – 570 | 445 | Missing in isoform 5. | VSP_015382 | ||||||||||||||
| Alternative sequence | 511 | 1 | A → V in isoform 3 and isoform 4. | VSP_015383 | ||||||||||||||
| Alternative sequence | 512 – 570 | 59 | Missing in isoform 3 and isoform 4. | VSP_015384 | ||||||||||||||
Experimental info | ||||||||||||||||||
| Mutagenesis | 235 | 1 | H → A: Abrogates RNA-binding by DRBM 3 and interaction with XPO5 and nuclear export; when associated with A-237. Ref.5 | |||||||||||||||
| Mutagenesis | 237 | 1 | K → A: Abrogates RNA-binding by DRBM 3 and interaction with XPO5 and nuclear export; when associated with A-235. Ref.5 | |||||||||||||||
| Mutagenesis | 273 – 274 | 2 | KK → AA: Prevents nuclear localization of mutants lacking DRBM 3 function; when associated with 289-AAA-291. | |||||||||||||||
| Mutagenesis | 289 – 291 | 3 | KKR → AAA: Prevents nuclear localization of mutants lacking DRBM 3 function; when associated with 257-AA-258. Ref.5 | |||||||||||||||
Secondary structure | ||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||
| Helix | 308 – 318 | 11 | ||||||||||||||||
| Beta strand | 325 – 333 | 9 | ||||||||||||||||
| Beta strand | 339 – 346 | 8 | ||||||||||||||||
| Beta strand | 349 – 357 | 9 | ||||||||||||||||
| Helix | 358 – 373 | 16 | ||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Staufen2 isoforms localize to the somatodendritic domain of neurons and interact with different organelles." Duchaine T.F., Hemraj I., Furic L., Deitinghoff A., Kiebler M.A., DesGroseillers L. J. Cell Sci. 115:3285-3295(2002) [PubMed: 12140260] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), RNA-BINDING, DOMAIN, TISSUE SPECIFICITY. Strain: BALB/c. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5). Strain: C57BL/6J. Tissue: Extraembryonic tissue, Placenta and Testis. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 42-570 (ISOFORMS 1/2). Strain: FVB/N. Tissue: Mammary tumor. |
| [4] | "Localization of the RNA-binding proteins Staufen1 and Staufen2 at the mammalian neuromuscular junction." Belanger G., Stocksley M.A., Vandromme M., Schaeffer L., Furic L., DesGroseillers L., Jasmin B.J. J. Neurochem. 86:669-677(2003) [PubMed: 12859680] [Abstract] Cited for: TISSUE SPECIFICITY, INDUCTION. |
| [5] | "The brain-specific double-stranded RNA-binding protein Staufen2: nucleolar accumulation and isoform-specific exportin-5-dependent export." Macchi P., Brownawell A.M., Grunewald B., DesGroseillers L., Macara I.G., Kiebler M.A. J. Biol. Chem. 279:31440-31444(2004) [PubMed: 15166236] [Abstract] Cited for: INTERACTION WITH XPO5, SUBCELLULAR LOCATION, DOMAIN NLS 1, MUTAGENESIS OF HIS-235; LYS-237; 273-LYS-LYS-274 AND 289-LYS--ARG-291. |
| [6] | "Solution structure of DSRNA binding domain in Staufen homolog 2." RIKEN structural genomics initiative (RSGI) Submitted (JUL-2003) to the PDB data bank Cited for: STRUCTURE BY NMR OF 308-383. |
| + | Additional computationally mapped references. |
Cross-references
Entry information
| Entry name | STAU2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8CJ67 Secondary accession number(s): Q8BSY8 Q9D5N7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with