Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cell division cycle protein 123 homolog

Gene

Cdc123

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Required for S phase entry of the cell cycle.By similarity

GO - Biological processi

Keywordsi

Biological processCell cycle, Cell division

Names & Taxonomyi

Protein namesi
Recommended name:
Cell division cycle protein 123 homolog
Gene namesi
Name:Cdc123
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:2138811 Cdc123

Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002286641 – 336Cell division cycle protein 123 homologAdd BLAST336

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei60PhosphoserineBy similarity1

Post-translational modificationi

Phosphorylated.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8CII2
PaxDbiQ8CII2
PeptideAtlasiQ8CII2
PRIDEiQ8CII2

PTM databases

iPTMnetiQ8CII2
PhosphoSitePlusiQ8CII2

Expressioni

Gene expression databases

BgeeiENSMUSG00000039128
CleanExiMM_CDC123
ExpressionAtlasiQ8CII2 baseline and differential
GenevisibleiQ8CII2 MM

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000043033

Structurei

3D structure databases

ProteinModelPortaliQ8CII2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the CDC123 family.Curated

Phylogenomic databases

eggNOGiKOG2983 Eukaryota
ENOG410XSVC LUCA
GeneTreeiENSGT00390000003057
HOGENOMiHOG000231938
HOVERGENiHBG080491
InParanoidiQ8CII2
OMAiALEFRCF
OrthoDBiEOG091G0A9C
PhylomeDBiQ8CII2
TreeFamiTF323348

Family and domain databases

InterProiView protein in InterPro
IPR009772 CDC123
PANTHERiPTHR15323 PTHR15323, 1 hit
PfamiView protein in Pfam
PF07065 D123, 1 hit
PIRSFiPIRSF007807 Cdc123, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8CII2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKKEHVSHCQ FSAWYPLFRS LTIKSVILPL PQNVKDYLLD DGTLVVSGRE
60 70 80 90 100
DPPTCSQSDS GNEAEETQWS DDESTATLTA PEFPEFNTQV QEAINSLGGS
110 120 130 140 150
VFPKLNWSAP RDAYWIAMNS SLKCKTLSDI FLLFKSSDFI THDFTQPFIH
160 170 180 190 200
CTDDSPDPCI EYELVLRKWC ELIPGAEFRC FVKENKLIGI SQRDYTQYYD
210 220 230 240 250
HISKQKEEIC RCIQDFFKEH LQYKFLDEDF VFDIYRDSRG KVWLIDFNPF
260 270 280 290 300
GEVTDSLLFT WEELTSENNL RGEVTEGDAQ EQDSPAFRCT NSEVTVQPSP
310 320 330
YLSFGLPKDF VDLSTGEDAH KLIDFLKLKR NEQEDD
Length:336
Mass (Da):38,816
Last modified:March 21, 2006 - v2
Checksum:i1E59461A424B7A76
GO
Isoform 2 (identifier: Q8CII2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     164-194: LVLRKWCELIPGAEFRCFVKENKLIGISQRD → PNLVQCLYLHDLCLPARATTYLLSIAFKIAP
     195-336: Missing.

Note: No experimental confirmation available.
Show »
Length:194
Mass (Da):21,833
Checksum:i5C3BBC8106FA9830
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti213I → T in AAH23821 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_017691164 – 194LVLRK…ISQRD → PNLVQCLYLHDLCLPARATT YLLSIAFKIAP in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_017692195 – 336Missing in isoform 2. 1 PublicationAdd BLAST142

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK090122 mRNA Translation: BAC41103.1
AK141463 mRNA Translation: BAE24692.1
AK159208 mRNA Translation: BAE34899.1
AK161246 mRNA Translation: BAE36265.1
BC019753 mRNA Translation: AAH19753.1
BC022972 mRNA Translation: AAH22972.1
BC023821 mRNA Translation: AAH23821.1
BC024787 mRNA Translation: AAH24787.1
CCDSiCCDS15666.1 [Q8CII2-1]
RefSeqiNP_598598.1, NM_133837.4 [Q8CII2-1]
XP_006497629.1, XM_006497566.2
UniGeneiMm.181490

Genome annotation databases

EnsembliENSMUST00000043864; ENSMUSP00000043033; ENSMUSG00000039128 [Q8CII2-1]
GeneIDi98828
KEGGimmu:98828
UCSCiuc008ift.1 mouse [Q8CII2-1]
uc008ifu.1 mouse [Q8CII2-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCD123_MOUSE
AccessioniPrimary (citable) accession number: Q8CII2
Secondary accession number(s): Q3TTR0, Q8VE51
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: March 21, 2006
Last modified: March 28, 2018
This is version 104 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health