Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cell division cycle protein 123 homolog

Gene

Cdc123

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at protein leveli

Functioni

Required for S phase entry of the cell cycle.By similarity

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Cell cycle, Cell division

Names & Taxonomyi

Protein namesi
Recommended name:
Cell division cycle protein 123 homolog
Gene namesi
Name:Cdc123
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:2138811. Cdc123.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 336336Cell division cycle protein 123 homologPRO_0000228664Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei60 – 601PhosphoserineBy similarity

Post-translational modificationi

Phosphorylated.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8CII2.
MaxQBiQ8CII2.
PaxDbiQ8CII2.
PRIDEiQ8CII2.

PTM databases

iPTMnetiQ8CII2.
PhosphoSiteiQ8CII2.

Expressioni

Gene expression databases

BgeeiQ8CII2.
CleanExiMM_CDC123.
ExpressionAtlasiQ8CII2. baseline and differential.
GenevisibleiQ8CII2. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000043033.

Structurei

3D structure databases

ProteinModelPortaliQ8CII2.
SMRiQ8CII2. Positions 1-328.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the CDC123 family.Curated

Phylogenomic databases

eggNOGiKOG2983. Eukaryota.
ENOG410XSVC. LUCA.
GeneTreeiENSGT00390000003057.
HOGENOMiHOG000231938.
HOVERGENiHBG080491.
InParanoidiQ8CII2.
OMAiNCQFSVW.
OrthoDBiEOG7673B4.
PhylomeDBiQ8CII2.
TreeFamiTF323348.

Family and domain databases

InterProiIPR009772. CDC123.
[Graphical view]
PANTHERiPTHR15323:SF6. PTHR15323:SF6. 1 hit.
PfamiPF07065. D123. 1 hit.
[Graphical view]
PIRSFiPIRSF007807. Cdc123. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8CII2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKKEHVSHCQ FSAWYPLFRS LTIKSVILPL PQNVKDYLLD DGTLVVSGRE
60 70 80 90 100
DPPTCSQSDS GNEAEETQWS DDESTATLTA PEFPEFNTQV QEAINSLGGS
110 120 130 140 150
VFPKLNWSAP RDAYWIAMNS SLKCKTLSDI FLLFKSSDFI THDFTQPFIH
160 170 180 190 200
CTDDSPDPCI EYELVLRKWC ELIPGAEFRC FVKENKLIGI SQRDYTQYYD
210 220 230 240 250
HISKQKEEIC RCIQDFFKEH LQYKFLDEDF VFDIYRDSRG KVWLIDFNPF
260 270 280 290 300
GEVTDSLLFT WEELTSENNL RGEVTEGDAQ EQDSPAFRCT NSEVTVQPSP
310 320 330
YLSFGLPKDF VDLSTGEDAH KLIDFLKLKR NEQEDD
Length:336
Mass (Da):38,816
Last modified:March 21, 2006 - v2
Checksum:i1E59461A424B7A76
GO
Isoform 2 (identifier: Q8CII2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     164-194: LVLRKWCELIPGAEFRCFVKENKLIGISQRD → PNLVQCLYLHDLCLPARATTYLLSIAFKIAP
     195-336: Missing.

Note: No experimental confirmation available.
Show »
Length:194
Mass (Da):21,833
Checksum:i5C3BBC8106FA9830
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti213 – 2131I → T in AAH23821 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei164 – 19431LVLRK…ISQRD → PNLVQCLYLHDLCLPARATT YLLSIAFKIAP in isoform 2. 1 PublicationVSP_017691Add
BLAST
Alternative sequencei195 – 336142Missing in isoform 2. 1 PublicationVSP_017692Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK090122 mRNA. Translation: BAC41103.1.
AK141463 mRNA. Translation: BAE24692.1.
AK159208 mRNA. Translation: BAE34899.1.
AK161246 mRNA. Translation: BAE36265.1.
BC019753 mRNA. Translation: AAH19753.1.
BC022972 mRNA. Translation: AAH22972.1.
BC023821 mRNA. Translation: AAH23821.1.
BC024787 mRNA. Translation: AAH24787.1.
CCDSiCCDS15666.1. [Q8CII2-1]
RefSeqiNP_598598.1. NM_133837.4. [Q8CII2-1]
XP_006497629.1. XM_006497566.2. [Q8CII2-2]
UniGeneiMm.181490.

Genome annotation databases

EnsembliENSMUST00000043864; ENSMUSP00000043033; ENSMUSG00000039128. [Q8CII2-1]
GeneIDi98828.
KEGGimmu:98828.
UCSCiuc008ift.1. mouse. [Q8CII2-1]
uc008ifu.1. mouse. [Q8CII2-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK090122 mRNA. Translation: BAC41103.1.
AK141463 mRNA. Translation: BAE24692.1.
AK159208 mRNA. Translation: BAE34899.1.
AK161246 mRNA. Translation: BAE36265.1.
BC019753 mRNA. Translation: AAH19753.1.
BC022972 mRNA. Translation: AAH22972.1.
BC023821 mRNA. Translation: AAH23821.1.
BC024787 mRNA. Translation: AAH24787.1.
CCDSiCCDS15666.1. [Q8CII2-1]
RefSeqiNP_598598.1. NM_133837.4. [Q8CII2-1]
XP_006497629.1. XM_006497566.2. [Q8CII2-2]
UniGeneiMm.181490.

3D structure databases

ProteinModelPortaliQ8CII2.
SMRiQ8CII2. Positions 1-328.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000043033.

PTM databases

iPTMnetiQ8CII2.
PhosphoSiteiQ8CII2.

Proteomic databases

EPDiQ8CII2.
MaxQBiQ8CII2.
PaxDbiQ8CII2.
PRIDEiQ8CII2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000043864; ENSMUSP00000043033; ENSMUSG00000039128. [Q8CII2-1]
GeneIDi98828.
KEGGimmu:98828.
UCSCiuc008ift.1. mouse. [Q8CII2-1]
uc008ifu.1. mouse. [Q8CII2-2]

Organism-specific databases

CTDi8872.
MGIiMGI:2138811. Cdc123.

Phylogenomic databases

eggNOGiKOG2983. Eukaryota.
ENOG410XSVC. LUCA.
GeneTreeiENSGT00390000003057.
HOGENOMiHOG000231938.
HOVERGENiHBG080491.
InParanoidiQ8CII2.
OMAiNCQFSVW.
OrthoDBiEOG7673B4.
PhylomeDBiQ8CII2.
TreeFamiTF323348.

Miscellaneous databases

PROiQ8CII2.
SOURCEiSearch...

Gene expression databases

BgeeiQ8CII2.
CleanExiMM_CDC123.
ExpressionAtlasiQ8CII2. baseline and differential.
GenevisibleiQ8CII2. MM.

Family and domain databases

InterProiIPR009772. CDC123.
[Graphical view]
PANTHERiPTHR15323:SF6. PTHR15323:SF6. 1 hit.
PfamiPF07065. D123. 1 hit.
[Graphical view]
PIRSFiPIRSF007807. Cdc123. 1 hit.
ProtoNetiSearch...

Publicationsi

  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: C57BL/6J.
    Tissue: Spinal cord and Testis.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: FVB/N and FVB/N-3.
    Tissue: Eye and Mammary tumor.
  3. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Kidney, Liver, Lung, Pancreas, Spleen and Testis.

Entry informationi

Entry nameiCD123_MOUSE
AccessioniPrimary (citable) accession number: Q8CII2
Secondary accession number(s): Q3TTR0, Q8VE51
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: March 21, 2006
Last modified: June 8, 2016
This is version 93 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.