Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

PDZ and LIM domain protein 5

Gene

Pdlim5

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May play an important role in the heart development by scaffolding PKC to the Z-disk region. Isoform 2 and isoform 3 may negatively modulate the scaffolding activity of isoform 1. May play a role in the regulation of cardiomyocyte expansion. Overexpression promotes the development of heart hypertrophy. Contributes to the regulation of dendritic spine morphogenesis in neurons. May restrain postsynaptic growth of excitatory synapses (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
PDZ and LIM domain protein 5
Alternative name(s):
Enigma homolog
Enigma-like PDZ and LIM domains protein
Gene namesi
Name:Pdlim5
Synonyms:Enh
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 3

Organism-specific databases

MGIiMGI:1927489. Pdlim5.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Membrane, Postsynaptic cell membrane, Synapse, Synaptosome

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00000758782 – 591PDZ and LIM domain protein 5Add BLAST590

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineBy similarity1
Modified residuei2PhosphoserineBy similarity1
Modified residuei89N6-acetyllysine; alternateCombined sources1
Modified residuei89N6-succinyllysine; alternateCombined sources1
Modified residuei111PhosphoserineBy similarity1
Modified residuei134PhosphoserineBy similarity1
Modified residuei137PhosphoserineBy similarity1
Modified residuei228PhosphoserineCombined sources1
Modified residuei260PhosphoserineBy similarity1
Modified residuei313PhosphoserineBy similarity1
Modified residuei322PhosphoserineBy similarity1
Modified residuei350N6-acetyllysineCombined sources1
Modified residuei359PhosphoserineBy similarity1
Modified residuei361PhosphoserineBy similarity1
Isoform 3 (identifier: Q8CI51-3)
Modified residuei102PhosphoserineCombined sources1
Modified residuei105PhosphoserineCombined sources1
Modified residuei218PhosphoserineCombined sources1
Isoform 2 (identifier: Q8CI51-2)
Modified residuei316PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ8CI51.
PaxDbiQ8CI51.
PeptideAtlasiQ8CI51.
PRIDEiQ8CI51.

PTM databases

iPTMnetiQ8CI51.
PhosphoSitePlusiQ8CI51.

Expressioni

Gene expression databases

BgeeiENSMUSG00000028273.
CleanExiMM_PDLIM5.
ExpressionAtlasiQ8CI51. baseline and differential.
GenevisibleiQ8CI51. MM.

Interactioni

Subunit structurei

Interacts with various PKC isoforms through the LIM domains. Interacts (via LIM domains) with SIPA1L1. Interacts (via PDZ domain) with actin and ACTN1 (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi207938. 28 interactors.
IntActiQ8CI51. 26 interactors.
MINTiMINT-1870155.
STRINGi10090.ENSMUSP00000029941.

Structurei

Secondary structure

1591
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi5 – 12Combined sources8
Beta strandi18 – 21Combined sources4
Turni22 – 25Combined sources4
Beta strandi26 – 30Combined sources5
Helixi38 – 41Combined sources4
Beta strandi49 – 53Combined sources5
Helixi63 – 72Combined sources10
Beta strandi74 – 81Combined sources8

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WF7NMR-A5-94[»]
ProteinModelPortaliQ8CI51.
SMRiQ8CI51.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8CI51.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini2 – 85PDZPROSITE-ProRule annotationAdd BLAST84
Domaini413 – 472LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST60
Domaini472 – 531LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST60
Domaini531 – 591LIM zinc-binding 3PROSITE-ProRule annotationAdd BLAST61

Sequence similaritiesi

Contains 3 LIM zinc-binding domains.PROSITE-ProRule annotation
Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

eggNOGiKOG1703. Eukaryota.
ENOG410XRD4. LUCA.
GeneTreeiENSGT00760000118910.
HOGENOMiHOG000220936.
HOVERGENiHBG051478.
InParanoidiQ8CI51.
OMAiLSADQCS.
TreeFamiTF106408.

Family and domain databases

Gene3Di2.10.110.10. 3 hits.
2.30.42.10. 1 hit.
InterProiIPR031847. DUF4749.
IPR001478. PDZ.
IPR001781. Znf_LIM.
[Graphical view]
PfamiPF15936. DUF4749. 1 hit.
PF00412. LIM. 3 hits.
PF00595. PDZ. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 3 hits.
SM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 3 hits.
PS50106. PDZ. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8CI51-1) [UniParc]FASTAAdd to basket
Also known as: ENH1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSNYSVSLVG PAPWGFRLQG GKDFNMPLTI SSLKDGGKAS QAHVRIGDVV
60 70 80 90 100
LSIDGISAQG MTHLEAQNKI KACTGSLNMT LQRASAAAKS EPVSVQKGEP
110 120 130 140 150
KEVVKPVPIT SPAVSKVTST TNMAYNKAPR PFGSVSSPKV TSIPSPSSAF
160 170 180 190 200
TPAHAATSSH ASPTPVAAAT PLHLSASGLH VSANLSADQC SSPPNTGKPA
210 220 230 240 250
VNVPRQPTVT SVCSESAQEL AEGQRRGSQG DIKQQNGPPR KHIVERNTEF
260 270 280 290 300
YHIPTHSDAS KKRLIEDTED WRPRTGTTQS RSFRILAQIT GTEHLTESEN
310 320 330 340 350
DNTKKANSTQ EPSQQPASSG ASPLSASEGP ESPGSSRPSV AGLRSAAAFK
360 370 380 390 400
PVGSTSVKSP SWQRPNQAAP STGRISNNAR SSGTGASVGP PQPSDQDTLV
410 420 430 440 450
QRAEHIPAGK RTPMCAHCNQ VIRGPFLVAL GKSWHPEEFN CAHCKNTMAY
460 470 480 490 500
IGFVEEKGAL YCELCYEKFF APECGRCQRK ILGEVINALK QTWHVSCFVC
510 520 530 540 550
VACGKPIRNN VFHLEDGEPY CETDYYALFG TICRGCEFPI EAGDMFLEAL
560 570 580 590
GYTWHDTCFV CSVCCESLEG QTFFSKKDKP LCKKHAHSVN F
Length:591
Mass (Da):63,299
Last modified:July 27, 2011 - v4
Checksum:iE12B9EE1A3D97DC1
GO
Isoform 2 (identifier: Q8CI51-2) [UniParc]FASTAAdd to basket
Also known as: ENH2

The sequence of this isoform differs from the canonical sequence as follows:
     307-337: NSTQEPSQQPASSGASPLSASEGPESPGSSR → KEKIPLHVFSPKYTKLRDWHHEVSARALNVQ
     338-591: Missing.

Show »
Length:337
Mass (Da):36,070
Checksum:iDDDBB44EFD25300F
GO
Isoform 3 (identifier: Q8CI51-3) [UniParc]FASTAAdd to basket
Also known as: ENH3

The sequence of this isoform differs from the canonical sequence as follows:
     98-206: Missing.
     237-237: G → GNPGTVKISPKR
     307-337: NSTQEPSQQPASSGASPLSASEGPESPGSSR → KEKIPLHVFSPKYTKLRDWHHEVSARALNVQ
     338-591: Missing.

Show »
Length:239
Mass (Da):26,346
Checksum:i83FF76D9DA4FBFD8
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti74T → M in AAH37476 (PubMed:15489334).Curated1
Sequence conflicti84A → T in BAA88827 (PubMed:10833443).Curated1
Sequence conflicti84A → T in BAA88829 (PubMed:10833443).Curated1
Sequence conflicti215E → D in BAA88827 (PubMed:10833443).Curated1
Sequence conflicti215E → D in BAA88829 (PubMed:10833443).Curated1
Sequence conflicti222E → K in BAA88827 (PubMed:10833443).Curated1
Sequence conflicti222E → K in BAA88829 (PubMed:10833443).Curated1
Sequence conflicti226R → K in BAA88827 (PubMed:10833443).Curated1
Sequence conflicti226R → K in BAA88829 (PubMed:10833443).Curated1
Sequence conflicti329G → R in BAA88827 (PubMed:10833443).Curated1
Sequence conflicti433S → P in BAA88827 (PubMed:10833443).Curated1
Sequence conflicti546F → Y in BAA88827 (PubMed:10833443).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01046798 – 206Missing in isoform 3. 1 PublicationAdd BLAST109
Alternative sequenceiVSP_010468237G → GNPGTVKISPKR in isoform 3. 1 Publication1
Alternative sequenceiVSP_010469307 – 337NSTQE…PGSSR → KEKIPLHVFSPKYTKLRDWH HEVSARALNVQ in isoform 2 and isoform 3. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_010470338 – 591Missing in isoform 2 and isoform 3. 1 PublicationAdd BLAST254

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB016586 mRNA. Translation: BAA88827.1.
AB016587 mRNA. Translation: BAA88828.1.
AB016588 mRNA. Translation: BAA88829.1.
AK147999 mRNA. Translation: BAE28279.1.
BC037476 mRNA. Translation: AAH37476.1.
CCDSiCCDS17875.1. [Q8CI51-1]
CCDS17876.1. [Q8CI51-2]
CCDS38656.1. [Q8CI51-3]
RefSeqiNP_001177781.1. NM_001190852.1.
NP_001177783.1. NM_001190854.1.
NP_001177784.1. NM_001190855.1.
NP_001177785.1. NM_001190856.1.
NP_062782.2. NM_019808.3. [Q8CI51-1]
UniGeneiMm.117709.

Genome annotation databases

EnsembliENSMUST00000029941; ENSMUSP00000029941; ENSMUSG00000028273. [Q8CI51-1]
ENSMUST00000196908; ENSMUSP00000143098; ENSMUSG00000028273. [Q8CI51-2]
GeneIDi56376.
KEGGimmu:56376.
UCSCiuc008rol.2. mouse. [Q8CI51-1]
uc008ron.2. mouse. [Q8CI51-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB016586 mRNA. Translation: BAA88827.1.
AB016587 mRNA. Translation: BAA88828.1.
AB016588 mRNA. Translation: BAA88829.1.
AK147999 mRNA. Translation: BAE28279.1.
BC037476 mRNA. Translation: AAH37476.1.
CCDSiCCDS17875.1. [Q8CI51-1]
CCDS17876.1. [Q8CI51-2]
CCDS38656.1. [Q8CI51-3]
RefSeqiNP_001177781.1. NM_001190852.1.
NP_001177783.1. NM_001190854.1.
NP_001177784.1. NM_001190855.1.
NP_001177785.1. NM_001190856.1.
NP_062782.2. NM_019808.3. [Q8CI51-1]
UniGeneiMm.117709.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WF7NMR-A5-94[»]
ProteinModelPortaliQ8CI51.
SMRiQ8CI51.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi207938. 28 interactors.
IntActiQ8CI51. 26 interactors.
MINTiMINT-1870155.
STRINGi10090.ENSMUSP00000029941.

PTM databases

iPTMnetiQ8CI51.
PhosphoSitePlusiQ8CI51.

Proteomic databases

EPDiQ8CI51.
PaxDbiQ8CI51.
PeptideAtlasiQ8CI51.
PRIDEiQ8CI51.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000029941; ENSMUSP00000029941; ENSMUSG00000028273. [Q8CI51-1]
ENSMUST00000196908; ENSMUSP00000143098; ENSMUSG00000028273. [Q8CI51-2]
GeneIDi56376.
KEGGimmu:56376.
UCSCiuc008rol.2. mouse. [Q8CI51-1]
uc008ron.2. mouse. [Q8CI51-2]

Organism-specific databases

CTDi10611.
MGIiMGI:1927489. Pdlim5.

Phylogenomic databases

eggNOGiKOG1703. Eukaryota.
ENOG410XRD4. LUCA.
GeneTreeiENSGT00760000118910.
HOGENOMiHOG000220936.
HOVERGENiHBG051478.
InParanoidiQ8CI51.
OMAiLSADQCS.
TreeFamiTF106408.

Miscellaneous databases

EvolutionaryTraceiQ8CI51.
PROiQ8CI51.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000028273.
CleanExiMM_PDLIM5.
ExpressionAtlasiQ8CI51. baseline and differential.
GenevisibleiQ8CI51. MM.

Family and domain databases

Gene3Di2.10.110.10. 3 hits.
2.30.42.10. 1 hit.
InterProiIPR031847. DUF4749.
IPR001478. PDZ.
IPR001781. Znf_LIM.
[Graphical view]
PfamiPF15936. DUF4749. 1 hit.
PF00412. LIM. 3 hits.
PF00595. PDZ. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 3 hits.
SM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 3 hits.
PS50106. PDZ. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPDLI5_MOUSE
AccessioniPrimary (citable) accession number: Q8CI51
Secondary accession number(s): Q3UGD0
, Q9QYN0, Q9QYN1, Q9QYN2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 24, 2004
Last sequence update: July 27, 2011
Last modified: November 2, 2016
This is version 133 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.