Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ephexin-1

Gene

Ngef

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as a guanine nucleotide exchange factor (GEF) which differentially activates the GTPases RHOA, RAC1 and CDC42. Plays a role in axon guidance regulating ephrin-induced growth cone collapse and dendritic spine morphogenesis. Upon activation by ephrin through EPHA4, the GEF activity switches toward RHOA resulting in its activation. Activated RHOA promotes cone retraction at the expense of RAC1- and CDC42-stimulated growth cone extension.3 Publications

GO - Molecular functioni

GO - Biological processi

  • cellular process Source: MGI
  • ephrin receptor signaling pathway Source: UniProtKB
  • negative regulation of dendritic spine morphogenesis Source: UniProtKB
  • positive regulation of GTPase activity Source: MGI
  • regulation of GTPase activity Source: UniProtKB
  • regulation of Rho protein signal transduction Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Guanine-nucleotide releasing factor

Keywords - Biological processi

Differentiation, Neurogenesis

Enzyme and pathway databases

ReactomeiR-MMU-193648. NRAGE signals death through JNK.
R-MMU-194840. Rho GTPase cycle.
R-MMU-3928663. EPHA-mediated growth cone collapse.
R-MMU-416482. G alpha (12/13) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
Ephexin-1
Alternative name(s):
Eph-interacting exchange protein
Neuronal guanine nucleotide exchange factor
Gene namesi
Name:Ngef
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 1

Organism-specific databases

MGIiMGI:1858414. Ngef.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cytoplasm, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi177 – 1771Y → F: Loss of ephrin-mediated growth cone collapse. No effect on interaction with EPHA4. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 710710Ephexin-1PRO_0000248389Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei177 – 1771PhosphotyrosineBy similarity

Post-translational modificationi

Src-dependent phosphorylation at Tyr-177 upon EPHA4 activation increases the guanine exchange factor activity toward RHOA. Phosphorylation by CDK5 upon EPHA4 activation by EFNA1 may regulate dendritic spine morphogenesis.2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8CHT1.
PaxDbiQ8CHT1.
PRIDEiQ8CHT1.

PTM databases

iPTMnetiQ8CHT1.

Expressioni

Tissue specificityi

Highly expressed in brain and to a lower extent in eye.1 Publication

Developmental stagei

Highly expressed in E7 and to a lower extent in E11, E15 and E17 embryos. Expressed at E16.5 in the lateral regions of the cortex.2 Publications

Gene expression databases

BgeeiQ8CHT1.
CleanExiMM_NGEF.
ExpressionAtlasiQ8CHT1. baseline and differential.
GenevisibleiQ8CHT1. MM.

Interactioni

Subunit structurei

Interacts with CDK5R1 and EPHA4; activated by EPHA4 through the CDK5 kinase.2 Publications

GO - Molecular functioni

  • ephrin receptor binding Source: UniProtKB

Protein-protein interaction databases

BioGridi207543. 1 interaction.
IntActiQ8CHT1. 2 interactions.
STRINGi10090.ENSMUSP00000066894.

Structurei

3D structure databases

ProteinModelPortaliQ8CHT1.
SMRiQ8CHT1. Positions 265-593, 613-674.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini273 – 457185DHPROSITE-ProRule annotationAdd
BLAST
Domaini489 – 601113PHPROSITE-ProRule annotationAdd
BLAST
Domaini612 – 67362SH3PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 272272Regulatory region; modulates activity toward RHOA, RAC1 and CDC42Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi214 – 22613Poly-GluAdd
BLAST

Domaini

The DH domain and the PH domain are both required to mediate interaction with EPHA4.

Sequence similaritiesi

Contains 1 DH (DBL-homology) domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

SH3 domain

Phylogenomic databases

eggNOGiKOG3523. Eukaryota.
COG5422. LUCA.
GeneTreeiENSGT00550000074493.
HOGENOMiHOG000007536.
HOVERGENiHBG058673.
InParanoidiQ8CHT1.
KOiK07525.
OrthoDBiEOG7NW68W.
PhylomeDBiQ8CHT1.

Family and domain databases

Gene3Di1.20.900.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR000219. DH-domain.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00621. RhoGEF. 1 hit.
PF14604. SH3_9. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00325. RhoGEF. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
SSF50044. SSF50044. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8CHT1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
METKNSEDWG KPQRKSESSS RKSNHGPAEM RPALPPENRE APETGEETQN
60 70 80 90 100
EEPRRLIPIQ RHSLFNRAVR HRHKARSTSE RRASDQADLP KMGKSVNERS
110 120 130 140 150
AFNLPQGRLS PWRTPAQRDT GAQEASESSS TPGNGTTPEE CPALTDSPTT
160 170 180 190 200
LTEALQMIHP IPADSWRNLI EQIGLLYQEY RDKSTLQEIE TRRQQDAEIQ
210 220 230 240 250
GNSDGSQVGE DAGEEEEEEE EGEEEELASP PERRALPQIC LLSNPHSRFN
260 270 280 290 300
LWQDLPEIQS SGVLDILQPE EIRLQEAMFE LVTSEASYYK SLNLLVSHFM
310 320 330 340 350
ENERLKKILH PSEAHILFSN VLDVMAVSER FLLELEHRME ENIVISDVCD
360 370 380 390 400
IVYRYAADHF SVYITYVSNQ TYQERTYKQL LQEKAAFREL IAQLELDPKC
410 420 430 440 450
KGLPFSSFLI LPFQRITRLK LLVQNILKRV EERSEREGTA LDAHKELEMV
460 470 480 490 500
VKACNEGVRK MSRTEQMISI QKKMEFKIKS VPIISHSRWL LKQGELQQMS
510 520 530 540 550
GPKTSRTLRT KKLFREIYLF LFNDLLVICR QIPGDKYQVF DSAPRGLLRV
560 570 580 590 600
EELEDQGQTL ANVFILRLLE NADDREATYM LKASSQSEMK RWMTSLAPNR
610 620 630 640 650
RTKFVSFTSR LLDCPQVQCV HPYVAQQPDE LTLELADILN ILEKTEDGWI
660 670 680 690 700
FGERLHDQER GWFPSSMTEE ILNPKIRSQN LKECFRVHKM EDPQRSQNKD
710
RRKLGSRNRQ
Length:710
Mass (Da):82,199
Last modified:March 1, 2003 - v1
Checksum:iF255DE351E02A586
GO
Isoform 2 (identifier: Q8CHT1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-90: Missing.
     91-125: KMGKSVNERSAFNLPQGRLSPWRTPAQRDTGAQEA → MELLAAAFSAACAVDHDSSTSESDTRDSAAGHLPG

Show »
Length:620
Mass (Da):71,416
Checksum:iC0B6A9C4E52A3107
GO

Sequence cautioni

The sequence AAH22680.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence CAC00698.1 differs from that shown. Reason: Frameshift at position 154. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti530 – 5301R → W in AAK71494 (PubMed:11336673).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 9090Missing in isoform 2. 2 PublicationsVSP_020262Add
BLAST
Alternative sequencei91 – 12535KMGKS…GAQEA → MELLAAAFSAACAVDHDSST SESDTRDSAAGHLPG in isoform 2. 2 PublicationsVSP_020263Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ238898 mRNA. Translation: CAC00698.1. Frameshift.
AY038025 mRNA. Translation: AAK71494.1.
BC022680 mRNA. Translation: AAH22680.1. Different initiation.
BC039279 mRNA. Translation: AAH39279.1.
CCDSiCCDS48306.1. [Q8CHT1-2]
CCDS48307.1. [Q8CHT1-1]
RefSeqiNP_001104784.1. NM_001111314.1.
NP_063920.2. NM_019867.2. [Q8CHT1-2]
UniGeneiMm.435439.

Genome annotation databases

EnsembliENSMUST00000027477; ENSMUSP00000027477; ENSMUSG00000026259. [Q8CHT1-2]
GeneIDi53972.
KEGGimmu:53972.
UCSCiuc007bwx.2. mouse. [Q8CHT1-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ238898 mRNA. Translation: CAC00698.1. Frameshift.
AY038025 mRNA. Translation: AAK71494.1.
BC022680 mRNA. Translation: AAH22680.1. Different initiation.
BC039279 mRNA. Translation: AAH39279.1.
CCDSiCCDS48306.1. [Q8CHT1-2]
CCDS48307.1. [Q8CHT1-1]
RefSeqiNP_001104784.1. NM_001111314.1.
NP_063920.2. NM_019867.2. [Q8CHT1-2]
UniGeneiMm.435439.

3D structure databases

ProteinModelPortaliQ8CHT1.
SMRiQ8CHT1. Positions 265-593, 613-674.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi207543. 1 interaction.
IntActiQ8CHT1. 2 interactions.
STRINGi10090.ENSMUSP00000066894.

PTM databases

iPTMnetiQ8CHT1.

Proteomic databases

MaxQBiQ8CHT1.
PaxDbiQ8CHT1.
PRIDEiQ8CHT1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000027477; ENSMUSP00000027477; ENSMUSG00000026259. [Q8CHT1-2]
GeneIDi53972.
KEGGimmu:53972.
UCSCiuc007bwx.2. mouse. [Q8CHT1-2]

Organism-specific databases

CTDi25791.
MGIiMGI:1858414. Ngef.

Phylogenomic databases

eggNOGiKOG3523. Eukaryota.
COG5422. LUCA.
GeneTreeiENSGT00550000074493.
HOGENOMiHOG000007536.
HOVERGENiHBG058673.
InParanoidiQ8CHT1.
KOiK07525.
OrthoDBiEOG7NW68W.
PhylomeDBiQ8CHT1.

Enzyme and pathway databases

ReactomeiR-MMU-193648. NRAGE signals death through JNK.
R-MMU-194840. Rho GTPase cycle.
R-MMU-3928663. EPHA-mediated growth cone collapse.
R-MMU-416482. G alpha (12/13) signalling events.

Miscellaneous databases

ChiTaRSiNgef. mouse.
PROiQ8CHT1.
SOURCEiSearch...

Gene expression databases

BgeeiQ8CHT1.
CleanExiMM_NGEF.
ExpressionAtlasiQ8CHT1. baseline and differential.
GenevisibleiQ8CHT1. MM.

Family and domain databases

Gene3Di1.20.900.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR000219. DH-domain.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00621. RhoGEF. 1 hit.
PF14604. SH3_9. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00325. RhoGEF. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
SSF50044. SSF50044. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization of Ngef, a novel member of the Dbl family of genes expressed predominantly in the caudate nucleus."
    Rodrigues N.R., Theodosiou A.M., Nesbit M.A., Campbell L., Tandle A.T., Saranath D., Davies K.E.
    Genomics 65:53-61(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Tissue: Brain.
  2. "EphA receptors regulate growth cone dynamics through the novel guanine nucleotide exchange factor ephexin."
    Shamah S.M., Lin M.Z., Goldberg J.L., Estrach S., Sahin M., Hu L., Bazalakova M., Neve R.L., Corfas G., Debant A., Greenberg M.E.
    Cell 105:233-244(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INTERACTION WITH EPHA4.
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: FVB/N.
    Tissue: Kidney.
  4. "Gene expression analysis of the late embryonic mouse cerebral cortex using DNA microarray: identification of several region- and layer-specific genes."
    Funatsu N., Inoue T., Nakamura S.
    Cereb. Cortex 14:1031-1044(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: DEVELOPMENTAL STAGE.
  5. "Src family kinases are involved in EphA receptor-mediated retinal axon guidance."
    Knoell B., Drescher U.
    J. Neurosci. 24:6248-6257(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION BY SRC FAMILY KINASES.
  6. Cited for: FUNCTION, MUTAGENESIS OF TYR-177.
  7. "Cdk5 regulates EphA4-mediated dendritic spine retraction through an ephexin1-dependent mechanism."
    Fu W.Y., Chen Y., Sahin M., Zhao X.S., Shi L., Bikoff J.B., Lai K.O., Yung W.H., Fu A.K., Greenberg M.E., Ip N.Y.
    Nat. Neurosci. 10:67-76(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN DENDRITIC SPINE MORPHOGENESIS, INTERACTION WITH EPHA4 AND CDK5R1, PHOSPHORYLATION BY CDK5.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain and Liver.

Entry informationi

Entry nameiNGEF_MOUSE
AccessioniPrimary (citable) accession number: Q8CHT1
Secondary accession number(s): Q8R204, Q923H2, Q9JHT9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 5, 2006
Last sequence update: March 1, 2003
Last modified: June 8, 2016
This is version 110 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.