Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rab11 family-interacting protein 3

Gene

Rab11fip3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as a regulator of endocytic traffic by participating in membrane delivery. Required for the abcission step in cytokinesis, possibly by acting as an 'address tag' delivering recycling endosome membranes to the cleavage furrow during late cytokinesis. Also required for the structural integrity of the endosomal recycling compartment during interphase.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi509 – 520121PROSITE-ProRule annotationAdd
BLAST
Calcium bindingi541 – 552122PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

  • cytokinesis Source: UniProtKB
  • endocytic recycling Source: UniProtKB
  • negative regulation of adiponectin secretion Source: MGI
  • protein localization to cilium Source: MGI
Complete GO annotation...

Keywords - Biological processi

Cell cycle, Cell division, Transport

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

ReactomeiR-MMU-5620916. VxPx cargo-targeting to cilium.

Names & Taxonomyi

Protein namesi
Recommended name:
Rab11 family-interacting protein 3
Short name:
FIP3-Rab11
Short name:
Rab11-FIP3
Gene namesi
Name:Rab11fip3
Synonyms:Kiaa0665
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 17

Organism-specific databases

MGIiMGI:2444431. Rab11fip3.

Subcellular locationi

  • Recycling endosome membrane By similarity; Peripheral membrane protein By similarity
  • Cytoplasmcytoskeletonmicrotubule organizing centercentrosome By similarity
  • Cleavage furrow By similarity
  • Midbody By similarity

  • Note: In early mitosis remains diffuse and distributed through the cell. The onset of anaphase sequesters these vesicles to the centrosomes at the opposite poles of the cell. During telophase these vesicles move from the centrosomes, to the furrow, and then to the midbody to aid in abscission. Interaction with Rab11 mediates localization to endosomes. Interaction with ARF6 mediates localization to the midbody.By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Endosome, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10471047Rab11 family-interacting protein 3PRO_0000390970Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei641 – 6411PhosphoserineBy similarity
Modified residuei765 – 7651PhosphoserineCombined sources
Modified residuei829 – 8291PhosphoserineBy similarity
Modified residuei938 – 9381PhosphoserineBy similarity
Modified residuei939 – 9391PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8CHD8.
PaxDbiQ8CHD8.
PRIDEiQ8CHD8.

PTM databases

iPTMnetiQ8CHD8.
PhosphoSiteiQ8CHD8.

Expressioni

Gene expression databases

BgeeiQ8CHD8.
ExpressionAtlasiQ8CHD8. baseline and differential.
GenevisibleiQ8CHD8. MM.

Interactioni

Subunit structurei

Homodimer. Forms a complex with Rab11 (RAB11A or RAB11B) and ARF6. Interacts with RAB11A; the interaction is direct. Interacts with RAB11B, RAB25 and RAB11FIP4. Interacts with ARF6. Interacts with RACGAP1/MgcRacGAP; interaction takes place during late stage of cytokinesis and is required for recruitment to the midbody. Interacts with EXOC7 (By similarity). Interacts with ASAP1.By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi229626. 1 interaction.
STRINGi10090.ENSMUSP00000113521.

Structurei

3D structure databases

ProteinModelPortaliQ8CHD8.
SMRiQ8CHD8. Positions 494-558, 752-795, 1006-1047.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini496 – 53136EF-hand 1PROSITE-ProRule annotationAdd
BLAST
Domaini528 – 56336EF-hand 2PROSITE-ProRule annotationAdd
BLAST
Domaini985 – 104763FIP-RBDPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni775 – 879105ARF-binding domain (ABD)By similarityAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili750 – 985236Sequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi37 – 451415Glu-richAdd
BLAST

Domaini

The RBD-FIP domain mediates the interaction with Rab11 (RAB11A or RAB11B).By similarity

Sequence similaritiesi

Contains 2 EF-hand domains.PROSITE-ProRule annotation
Contains 1 FIP-RBD domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiKOG0982. Eukaryota.
ENOG4111K32. LUCA.
GeneTreeiENSGT00440000033742.
HOGENOMiHOG000063670.
HOVERGENiHBG054059.
InParanoidiQ8CHD8.
KOiK12485.
OrthoDBiEOG793B75.
PhylomeDBiQ8CHD8.
TreeFamiTF327221.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
InterProiIPR011992. EF-hand-dom_pair.
IPR002048. EF_hand_dom.
IPR019018. Rab-bd_FIP-RBD.
IPR032920. Rab11-FIP3.
[Graphical view]
PANTHERiPTHR15726:SF6. PTHR15726:SF6. 1 hit.
PfamiPF09457. RBD-FIP. 1 hit.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS50222. EF_HAND_2. 2 hits.
PS51511. FIP_RBD. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8CHD8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MELCQPTSLS DHDQPASGPQ RGVMGLVGPD APRGWSEEPE EHAQLQRWPE
60 70 80 90 100
GPNAPICWPE EVEEPHAPSR WAKEPNAPRC SSQEPDESCH LAEELEESDS
110 120 130 140 150
PRCWPQEPDT PCHLAKELEE PDAPRCLPQE PDTPCYLAKE LEEPNIPRCW
160 170 180 190 200
PQEPDVPCHL AKELEEPDAP RCWPQEPDAF CHLLKEVEEP DALRCWLQGP
210 220 230 240 250
DAPCHLAKEL EDLDSPRCWP QEPDESCHLA KELEEPDAPC HLAKELEEPD
260 270 280 290 300
APRCWPQEPD VPCLLAKKWE ESDAPCLLTE ELEEPDALHC WPQESEAPCL
310 320 330 340 350
LAKELEEPDA SHSCPQEADT GCLSAKEPEE PDVSHLWQGV PDAPCLLVKE
360 370 380 390 400
PEEADALHCC WPEESEEPDA LNPPCFWANE PDEPDPSRCW SEEPQVLCLW
410 420 430 440 450
PEEQNTKRCW QEEPDAPCFW PEDREEPIVS CLQFKEPEKP KVRSSWPEEL
460 470 480 490 500
EDCCPTRGLP LEPLLADGEL LQACPGPPSD PGPALSLPSE PGTAQEEGAR
510 520 530 540 550
LRAVFDALDR DGDGFVRIED FIQFATVYGA EQVKDLTQYL DPSGLGVISF
560 570 580 590 600
EDFYQGIVAI RNGDPDGQLY SVEPVQDEET PACADEFDDF VTYEANEVTD
610 620 630 640 650
SAYMGSESTY SECETFTDED TSTLVHPELQ PEGDVDSAGG SGVPSECLDT
660 670 680 690 700
MEEPDHGALL LLPGRSRPHS QAVVMVIGSE EHFEDYGEGN EAELSPETLC
710 720 730 740 750
DGDGEDPAFL TPSPAKRLSS RKVARYLHQS GTLTMEALED PPPEPVECPE
760 770 780 790 800
EDIADKVIFL ERRVSELEKD SAAAGEQHGR LRQENLQLVH RANALEEQLK
810 820 830 840 850
EQEFRAQEKV LEETRKQKEL LCKMEREKSI EIENLQARLQ QLDEENSELR
860 870 880 890 900
SCTPCLKANI ERLEEEKQKM LDEIEELTQR LSEEQENKRK MGDRLSHERH
910 920 930 940 950
QFQRDKEATQ ELIEDLRKQL EHLQLLRLEV EQRRGRSSSL GLQEYNSRAR
960 970 980 990 1000
ESELEQEVRR LKQDNRNLKE QNDELNGQII TLSIQGAKSL FSTSFSESLA
1010 1020 1030 1040
AEISSVSRDE LMEAIQKQEE INFRLQDYID RIIVAILETN PSILEVK
Length:1,047
Mass (Da):118,535
Last modified:January 19, 2010 - v2
Checksum:i4A78951AFB9696C4
GO
Isoform 2 (identifier: Q8CHD8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-603: Missing.

Note: No experimental confirmation available.
Show »
Length:444
Mass (Da):50,831
Checksum:i5B69706DD31E2A94
GO
Isoform 3 (identifier: Q8CHD8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     712-712: P → PSSNPLASKLCDVLTDEAFEFYCSQCHKQINRLEDLSARLTDLEMN

Note: No experimental confirmation available.
Show »
Length:1,092
Mass (Da):123,667
Checksum:iB33AF460152531B0
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 603603Missing in isoform 2. 1 PublicationVSP_038667Add
BLAST
Alternative sequencei712 – 7121P → PSSNPLASKLCDVLTDEAFE FYCSQCHKQINRLEDLSARL TDLEMN in isoform 3. 1 PublicationVSP_038668

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC140047 Genomic DNA. No translation available.
AC159277 Genomic DNA. No translation available.
BC023364 mRNA. Translation: AAH23364.1.
BC037132 mRNA. Translation: AAH37132.1.
AB093257 mRNA. Translation: BAC41441.1.
CCDSiCCDS50039.1. [Q8CHD8-2]
CCDS50040.1. [Q8CHD8-1]
CCDS50041.1. [Q8CHD8-3]
RefSeqiNP_001156340.1. NM_001162868.1. [Q8CHD8-1]
NP_001156341.1. NM_001162869.1. [Q8CHD8-3]
NP_694780.1. NM_153140.2. [Q8CHD8-2]
UniGeneiMm.41191.

Genome annotation databases

EnsembliENSMUST00000118828; ENSMUSP00000113048; ENSMUSG00000037098. [Q8CHD8-2]
ENSMUST00000120691; ENSMUSP00000112875; ENSMUSG00000037098. [Q8CHD8-1]
ENSMUST00000122103; ENSMUSP00000113521; ENSMUSG00000037098. [Q8CHD8-3]
GeneIDi215445.
KEGGimmu:215445.
UCSCiuc008bdc.2. mouse. [Q8CHD8-2]
uc008bdd.2. mouse. [Q8CHD8-3]
uc008bde.2. mouse. [Q8CHD8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC140047 Genomic DNA. No translation available.
AC159277 Genomic DNA. No translation available.
BC023364 mRNA. Translation: AAH23364.1.
BC037132 mRNA. Translation: AAH37132.1.
AB093257 mRNA. Translation: BAC41441.1.
CCDSiCCDS50039.1. [Q8CHD8-2]
CCDS50040.1. [Q8CHD8-1]
CCDS50041.1. [Q8CHD8-3]
RefSeqiNP_001156340.1. NM_001162868.1. [Q8CHD8-1]
NP_001156341.1. NM_001162869.1. [Q8CHD8-3]
NP_694780.1. NM_153140.2. [Q8CHD8-2]
UniGeneiMm.41191.

3D structure databases

ProteinModelPortaliQ8CHD8.
SMRiQ8CHD8. Positions 494-558, 752-795, 1006-1047.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi229626. 1 interaction.
STRINGi10090.ENSMUSP00000113521.

PTM databases

iPTMnetiQ8CHD8.
PhosphoSiteiQ8CHD8.

Proteomic databases

MaxQBiQ8CHD8.
PaxDbiQ8CHD8.
PRIDEiQ8CHD8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000118828; ENSMUSP00000113048; ENSMUSG00000037098. [Q8CHD8-2]
ENSMUST00000120691; ENSMUSP00000112875; ENSMUSG00000037098. [Q8CHD8-1]
ENSMUST00000122103; ENSMUSP00000113521; ENSMUSG00000037098. [Q8CHD8-3]
GeneIDi215445.
KEGGimmu:215445.
UCSCiuc008bdc.2. mouse. [Q8CHD8-2]
uc008bdd.2. mouse. [Q8CHD8-3]
uc008bde.2. mouse. [Q8CHD8-1]

Organism-specific databases

CTDi9727.
MGIiMGI:2444431. Rab11fip3.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG0982. Eukaryota.
ENOG4111K32. LUCA.
GeneTreeiENSGT00440000033742.
HOGENOMiHOG000063670.
HOVERGENiHBG054059.
InParanoidiQ8CHD8.
KOiK12485.
OrthoDBiEOG793B75.
PhylomeDBiQ8CHD8.
TreeFamiTF327221.

Enzyme and pathway databases

ReactomeiR-MMU-5620916. VxPx cargo-targeting to cilium.

Miscellaneous databases

ChiTaRSiRab11fip3. mouse.
PROiQ8CHD8.
SOURCEiSearch...

Gene expression databases

BgeeiQ8CHD8.
ExpressionAtlasiQ8CHD8. baseline and differential.
GenevisibleiQ8CHD8. MM.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
InterProiIPR011992. EF-hand-dom_pair.
IPR002048. EF_hand_dom.
IPR019018. Rab-bd_FIP-RBD.
IPR032920. Rab11-FIP3.
[Graphical view]
PANTHERiPTHR15726:SF6. PTHR15726:SF6. 1 hit.
PfamiPF09457. RBD-FIP. 1 hit.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS50222. EF_HAND_2. 2 hits.
PS51511. FIP_RBD. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Strain: FVB/N.
    Tissue: Kidney.
  3. "Prediction of the coding sequences of mouse homologues of KIAA gene: I. The complete nucleotide sequences of 100 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Hara Y., Nagase T., Ohara O., Koga H.
    DNA Res. 9:179-188(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 188-1047 (ISOFORM 2).
    Tissue: Brain.
  4. "Arf GTPase-activating protein ASAP1 interacts with Rab11 effector FIP3 and regulates pericentrosomal localization of transferrin receptor-positive recycling endosome."
    Inoue H., Ha V.L., Prekeris R., Randazzo P.A.
    Mol. Biol. Cell 19:4224-4237(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH ASAP1.
  5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-765, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Kidney and Testis.

Entry informationi

Entry nameiRFIP3_MOUSE
AccessioniPrimary (citable) accession number: Q8CHD8
Secondary accession number(s): Q8JZT3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 19, 2010
Last sequence update: January 19, 2010
Last modified: June 8, 2016
This is version 107 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.