Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8CFA1 (IRAK2_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 89. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Interleukin-1 receptor-associated kinase-like 2

Short name=IRAK-2
Short name=mu-IRAK-2
Gene names
Name:Irak2
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length622 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Binds to the IL-1 type I receptor following IL-1 engagement, triggering intracellular signaling cascades leading to transcriptional up-regulation and mRNA stabilization By similarity.

Subunit structure

Interacts with MYD88. IL-1 stimulation leads to the formation of a signaling complex which dissociates from the IL-1 receptor following the binding of PELI1 By similarity.

Tissue specificity

Ubiquitously expressed, with a higher expression observed in brain, spleen and liver. Isoform 1 and isoform 2 are considered agonist and isoform 3 and isoform 4 are considered antagonist.

Domain

The protein kinase domain is predicted to be catalytically inactive.

Sequence similarities

Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. Pelle subfamily.

Contains 1 death domain.

Contains 1 protein kinase domain.

Caution

Asn-333 is present instead of the conserved Asp which is expected to be an active site residue.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8CFA1-1)

Also known as: IRAK-2a;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8CFA1-2)

Also known as: IRAK-2b;

The sequence of this isoform differs from the canonical sequence as follows:
     94-141: Missing.
Isoform 3 (identifier: Q8CFA1-3)

Also known as: IRAK-2d;

The sequence of this isoform differs from the canonical sequence as follows:
     32-93: ASYVITDLTQLRKIKSMERVQGVSITRELLWWWSMRQATVQQLVDLLCHLELYRAAQIVLSW → G
     490-499: Missing.
Isoform 4 (identifier: Q8CFA1-4)

Also known as: IRAK-2c;

The sequence of this isoform differs from the canonical sequence as follows:
     1-143: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 622622Interleukin-1 receptor-associated kinase-like 2
PRO_0000277560

Regions

Domain13 – 9482Death
Domain208 – 473266Protein kinase
Nucleotide binding214 – 2229ATP By similarity
Nucleotide binding335 – 3384ATP By similarity

Sites

Binding site2351ATP By similarity

Natural variations

Alternative sequence1 – 143143Missing in isoform 4.
VSP_023025
Alternative sequence32 – 9362ASYVI…IVLSW → G in isoform 3.
VSP_023026
Alternative sequence94 – 14148Missing in isoform 2.
VSP_023027
Alternative sequence490 – 49910Missing in isoform 3.
VSP_023028

Experimental info

Sequence conflict1291V → A in BAE28437. Ref.3
Sequence conflict142 – 15110PIMAGAQRQR → ALLPSFLLLF in BAC28438. Ref.3
Sequence conflict1511R → V in BAC37114. Ref.3
Sequence conflict188 – 1903GLP → SLH in BAE28437. Ref.3
Sequence conflict2671V → I in BAE28437. Ref.3
Sequence conflict2731F → V in BAE28437. Ref.3
Sequence conflict3431Q → R in BAC37114. Ref.3
Sequence conflict3451L → F in AAH85324. Ref.4
Sequence conflict4381C → G in BAE28437. Ref.3
Sequence conflict4481V → E in AAO24761. Ref.2
Sequence conflict4481V → E in AAO24762. Ref.2
Sequence conflict4481V → E in AAO24763. Ref.2
Sequence conflict4481V → E in AAO24764. Ref.2
Sequence conflict4591K → R in BAE28437. Ref.3
Sequence conflict5091W → G in AAH85324. Ref.4
Sequence conflict5351S → G in BAC26088. Ref.3
Sequence conflict5541F → S in BAE28437. Ref.3
Sequence conflict5851N → D in BAE28437. Ref.3
Sequence conflict5991K → E in BAE28437. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (IRAK-2a) [UniParc].

Last modified June 1, 2003. Version 2.
Checksum: AD4692A0B6BFE733

FASTA62269,047
        10         20         30         40         50         60 
MACYIYQLPS WVLDDLCRNI DTLSEWDWMQ FASYVITDLT QLRKIKSMER VQGVSITREL 

        70         80         90        100        110        120 
LWWWSMRQAT VQQLVDLLCH LELYRAAQIV LSWKPVPEST SPLPAFPEAV KPGAVATSRR 

       130        140        150        160        170        180 
NLKDEQEKVR PVKPRSLLDT GPIMAGAQRQ RPCEMDAPCS LKTDAPDSPQ SKYCSTSTSA 

       190        200        210        220        230        240 
PKQERLLGLP GDRLFWSEAD VVQATEDFDQ SHRISEGTFA DIYQGQRNGV AFAFKKLREV 

       250        260        270        280        290        300 
AGSSPGSMDR FLQAEMQLCL RCCHANVLPL LGFCTGRQFH SLIYPYMANG SLHDRLWAQG 

       310        320        330        340        350        360 
NSDMLPWPQR ASICSGLLLA VEHLHSLDII HSNVKSANVL LDQHLNPKLA HPVAHPHPDN 

       370        380        390        400        410        420 
KKTKYTVMRT HLFQASAAYL PEHFIRVGQL TKQVDIFSCG IVLAEVLTGI PAMDKDRSPV 

       430        440        450        460        470        480 
YLKDLLLSEI PNSTSSVCSR KTSMGKAVVK EICQRHVEKR AGLLPEACEE AWATAVSVCL 

       490        500        510        520        530        540 
RRRNASVEEA RVSLAGVEEQ LRGQLSLPWS RVSEATGSSS NTPEETDDVD NSSLSVPSLV 

       550        560        570        580        590        600 
MMASCPGAAS SPLFTGHGAA QPSTSGRQEA DSSSEACTGP QTPQNATETS WKIEINEAKR 

       610        620 
RLMENIVLYK EERLDSSELF GP 

« Hide

Isoform 2 (IRAK-2b) [UniParc].

Checksum: EFA629937D2F6335
Show »

FASTA57463,870
Isoform 3 (IRAK-2d) [UniParc].

Checksum: E4030CE5C6EB366A
Show »

FASTA55160,734
Isoform 4 (IRAK-2c) [UniParc].

Checksum: A029C4439FAC23D2
Show »

FASTA47952,463

References

« Hide 'large scale' references
[1]"Identification and characterization of murine IRAK-2."
Rosati O., Martin M.U.
Biochem. Biophys. Res. Commun. 297:52-58(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Strain: BALB/c.
[2]"The murine IRAK2 gene encodes four alternatively spliced isoforms, two of which are inhibitory."
Hardy M.P., O'Neill L.A.
J. Biol. Chem. 279:27699-27708(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4).
Strain: C57BL/6.
[3]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Strain: C57BL/6J and NOD.
Tissue: Bone marrow, Cecum, Medulla oblongata and Skin.
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Tissue: Trophoblast stem cell.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AJ440756 mRNA. Translation: CAD29447.2.
AY162378 mRNA. Translation: AAO24761.1.
AY162379 mRNA. Translation: AAO24762.1.
AY162380 mRNA. Translation: AAO24763.1.
AY162381 mRNA. Translation: AAO24764.1.
AK028733 mRNA. Translation: BAC26088.1.
AK033707 mRNA. Translation: BAC28438.1.
AK078062 mRNA. Translation: BAC37114.1.
AK148248 mRNA. Translation: BAE28437.1.
AK150056 mRNA. Translation: BAE29271.1.
AK151428 mRNA. Translation: BAE30392.1.
AK152682 mRNA. Translation: BAE31414.1.
AK154715 mRNA. Translation: BAE32783.1.
BC085324 mRNA. Translation: AAH85324.1.
RefSeqNP_001107025.1. NM_001113553.1.
NP_751893.3. NM_172161.4.
XP_006505388.1. XM_006505325.1.
UniGeneMm.152142.

3D structure databases

ProteinModelPortalQ8CFA1.
SMRQ8CFA1. Positions 2-94, 195-499.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid224495. 2 interactions.
DIPDIP-49685N.
IntActQ8CFA1. 2 interactions.

PTM databases

PhosphoSiteQ8CFA1.

Proteomic databases

PRIDEQ8CFA1.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000059286; ENSMUSP00000055073; ENSMUSG00000060477. [Q8CFA1-1]
ENSMUST00000089022; ENSMUSP00000086416; ENSMUSG00000060477. [Q8CFA1-2]
ENSMUST00000089023; ENSMUSP00000086417; ENSMUSG00000060477. [Q8CFA1-3]
ENSMUST00000113024; ENSMUSP00000108647; ENSMUSG00000060477. [Q8CFA1-4]
GeneID108960.
KEGGmmu:108960.
UCSCuc009dhc.3. mouse. [Q8CFA1-1]
uc009dhe.3. mouse. [Q8CFA1-2]
uc012eqf.2. mouse. [Q8CFA1-3]

Organism-specific databases

CTD3656.
MGIMGI:2429603. Irak2.

Phylogenomic databases

eggNOGCOG0515.
GeneTreeENSGT00530000063073.
HOVERGENHBG052145.
InParanoidQ8CFA1.
KOK04731.
OMALSEWDWM.
OrthoDBEOG747PHP.
PhylomeDBQ8CFA1.
TreeFamTF328924.

Gene expression databases

BgeeQ8CFA1.
CleanExMM_IRAK2.
GenevestigatorQ8CFA1.

Family and domain databases

Gene3D1.10.533.10. 1 hit.
InterProIPR011029. DEATH-like_dom.
IPR000488. Death_domain.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
[Graphical view]
PfamPF00531. Death. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view]
SUPFAMSSF47986. SSF47986. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEPS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSIRAK2. mouse.
NextBio361524.
PROQ8CFA1.
SOURCESearch...

Entry information

Entry nameIRAK2_MOUSE
AccessionPrimary (citable) accession number: Q8CFA1
Secondary accession number(s): Q3U3K2 expand/collapse secondary AC list , Q3U7F5, Q3UFX2, Q5U404, Q6YBR8, Q6YBR9, Q6YBS0, Q6YBS1, Q8C5M0, Q8CC82, Q8CEA0
Entry history
Integrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: June 1, 2003
Last modified: April 16, 2014
This is version 89 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human and mouse protein kinases

Human and mouse protein kinases: classification and index

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot