Q8CFA1 (IRAK2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 81.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Interleukin-1 receptor-associated kinase-like 2 Short name=IRAK-2 Short name=mu-IRAK-2 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 622 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Binds to the IL-1 type I receptor following IL-1 engagement, triggering intracellular signaling cascades leading to transcriptional up-regulation and mRNA stabilization By similarity. |
| Subunit structure | Interacts with MYD88. IL-1 stimulation leads to the formation of a signaling complex which dissociates from the IL-1 receptor following the binding of PELI1 By similarity. |
| Tissue specificity | Ubiquitously expressed, with a higher expression observed in brain, spleen and liver. Isoform 1 and isoform 2 are considered agonist and isoform 3 and isoform 4 are considered antagonist. |
| Domain | The protein kinase domain is predicted to be catalytically inactive. |
| Sequence similarities | Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. Pelle subfamily. Contains 1 death domain. Contains 1 protein kinase domain. |
| Caution | Asn-333 is present instead of the conserved Asp which is expected to be an active site residue. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8CFA1-1) Also known as: IRAK-2a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8CFA1-2) Also known as: IRAK-2b; The sequence of this isoform differs from the canonical sequence as follows: 94-141: Missing. | ||||||
| Isoform 3 (identifier: Q8CFA1-3) Also known as: IRAK-2d; The sequence of this isoform differs from the canonical sequence as follows: 32-93: ASYVITDLTQLRKIKSMERVQGVSITRELLWWWSMRQATVQQLVDLLCHLELYRAAQIVLSW → G 490-499: Missing. | ||||||
| Isoform 4 (identifier: Q8CFA1-4) Also known as: IRAK-2c; The sequence of this isoform differs from the canonical sequence as follows: 1-143: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 622 | 622 | Interleukin-1 receptor-associated kinase-like 2 | PRO_0000277560 | |||||
Regions | |||||||||
| Domain | 13 – 94 | 82 | Death | ||||||
| Domain | 208 – 473 | 266 | Protein kinase | ||||||
| Nucleotide binding | 214 – 222 | 9 | ATP By similarity | ||||||
| Nucleotide binding | 335 – 338 | 4 | ATP By similarity | ||||||
Sites | |||||||||
| Binding site | 235 | 1 | ATP By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 143 | 143 | Missing in isoform 4. | VSP_023025 | |||||
| Alternative sequence | 32 – 93 | 62 | ASYVI…IVLSW → G in isoform 3. | VSP_023026 | |||||
| Alternative sequence | 94 – 141 | 48 | Missing in isoform 2. | VSP_023027 | |||||
| Alternative sequence | 490 – 499 | 10 | Missing in isoform 3. | VSP_023028 | |||||
Experimental info | |||||||||
| Sequence conflict | 129 | 1 | V → A in BAE28437. Ref.3 | ||||||
| Sequence conflict | 142 – 151 | 10 | PIMAGAQRQR → ALLPSFLLLF in BAC28438. Ref.3 | ||||||
| Sequence conflict | 151 | 1 | R → V in BAC37114. Ref.3 | ||||||
| Sequence conflict | 188 – 190 | 3 | GLP → SLH in BAE28437. Ref.3 | ||||||
| Sequence conflict | 267 | 1 | V → I in BAE28437. Ref.3 | ||||||
| Sequence conflict | 273 | 1 | F → V in BAE28437. Ref.3 | ||||||
| Sequence conflict | 343 | 1 | Q → R in BAC37114. Ref.3 | ||||||
| Sequence conflict | 345 | 1 | L → F in AAH85324. Ref.4 | ||||||
| Sequence conflict | 438 | 1 | C → G in BAE28437. Ref.3 | ||||||
| Sequence conflict | 448 | 1 | V → E in AAO24761. Ref.2 | ||||||
| Sequence conflict | 448 | 1 | V → E in AAO24762. Ref.2 | ||||||
| Sequence conflict | 448 | 1 | V → E in AAO24763. Ref.2 | ||||||
| Sequence conflict | 448 | 1 | V → E in AAO24764. Ref.2 | ||||||
| Sequence conflict | 459 | 1 | K → R in BAE28437. Ref.3 | ||||||
| Sequence conflict | 509 | 1 | W → G in AAH85324. Ref.4 | ||||||
| Sequence conflict | 535 | 1 | S → G in BAC26088. Ref.3 | ||||||
| Sequence conflict | 554 | 1 | F → S in BAE28437. Ref.3 | ||||||
| Sequence conflict | 585 | 1 | N → D in BAE28437. Ref.3 | ||||||
| Sequence conflict | 599 | 1 | K → E in BAE28437. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and characterization of murine IRAK-2." Rosati O., Martin M.U. Biochem. Biophys. Res. Commun. 297:52-58(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Strain: BALB/c. |
| [2] | "The murine IRAK2 gene encodes four alternatively spliced isoforms, two of which are inhibitory." Hardy M.P., O'Neill L.A. J. Biol. Chem. 279:27699-27708(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4). Strain: C57BL/6. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Strain: C57BL/6J and NOD. Tissue: Bone marrow, Cecum, Medulla oblongata and Skin. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Trophoblast stem cell. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ440756 mRNA. Translation: CAD29447.2. AY162378 mRNA. Translation: AAO24761.1. AY162379 mRNA. Translation: AAO24762.1. AY162380 mRNA. Translation: AAO24763.1. AY162381 mRNA. Translation: AAO24764.1. AK028733 mRNA. Translation: BAC26088.1. AK033707 mRNA. Translation: BAC28438.1. AK078062 mRNA. Translation: BAC37114.1. AK148248 mRNA. Translation: BAE28437.1. AK150056 mRNA. Translation: BAE29271.1. AK151428 mRNA. Translation: BAE30392.1. AK152682 mRNA. Translation: BAE31414.1. AK154715 mRNA. Translation: BAE32783.1. BC085324 mRNA. Translation: AAH85324.1. |
| IPI | IPI00420934. IPI00468594. IPI00624206. IPI00828977. |
| RefSeq | NP_001107025.1. NM_001113553.1. NP_751893.3. NM_172161.4. |
| UniGene | Mm.152142. |
3D structure databases | |
| ProteinModelPortal | Q8CFA1. |
| SMR | Q8CFA1. Positions 2-94, 188-476. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-49685N. |
| IntAct | Q8CFA1. 1 interaction. |
PTM databases | |
| PhosphoSite | Q8CFA1. |
Proteomic databases | |
| PRIDE | Q8CFA1. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000059286; ENSMUSP00000055073; ENSMUSG00000060477. ENSMUST00000089022; ENSMUSP00000086416; ENSMUSG00000060477. ENSMUST00000089023; ENSMUSP00000086417; ENSMUSG00000060477. ENSMUST00000113024; ENSMUSP00000108647; ENSMUSG00000060477. |
| GeneID | 108960. |
| KEGG | mmu:108960. |
| UCSC | uc009dhc.3. mouse. uc009dhe.3. mouse. uc012eqf.2. mouse. |
Organism-specific databases | |
| CTD | 3656. |
| MGI | MGI:2429603. Irak2. |
Phylogenomic databases | |
| eggNOG | COG0515. |
| GeneTree | ENSGT00530000063073. |
| HOVERGEN | HBG052145. |
| InParanoid | Q8CFA1. |
| KO | K04731. |
| OMA | PWSGLSE. |
| OrthoDB | EOG4R23TT. |
Gene expression databases | |
| ArrayExpress | Q8CFA1. |
| Bgee | Q8CFA1. |
| CleanEx | MM_IRAK2. |
| Genevestigator | Q8CFA1. |
Family and domain databases | |
| Gene3D | 1.10.533.10. 1 hit. |
| InterPro | IPR011029. DEATH-like_dom. IPR000488. Death_domain. IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. [Graphical view] |
| Pfam | PF00531. Death. 1 hit. PF00069. Pkinase. 1 hit. [Graphical view] |
| SUPFAM | SSF47986. DEATH_like. 1 hit. SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS50017. DEATH_DOMAIN. False negative. PS00107. PROTEIN_KINASE_ATP. False negative. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | IRAK2. mouse. |
| NextBio | 361524. |
| SOURCE | Search... |
Entry information
| Entry name | IRAK2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8CFA1 Secondary accession number(s): Q3U3K2 Q8CEA0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
