Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

N-alpha-acetyltransferase 30

Gene

Naa30

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Catalytic subunit of the N-terminal acetyltransferase C (NatC) complex. Catalyzes acetylation of the N-terminal methionine residues of peptides beginning with Met-Leu-Ala and Met-Leu-Gly. Necessary for the lysosomal localization and function of ARL8B sugeesting that ARL8B is a NatC substrate (By similarity).By similarity

Catalytic activityi

Acetyl-CoA + peptide = N(alpha)-acetylpeptide + CoA.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Acyltransferase, Transferase

Names & Taxonomyi

Protein namesi
Recommended name:
N-alpha-acetyltransferase 30 (EC:2.3.1.88)
Alternative name(s):
N-acetyltransferase 12
N-acetyltransferase MAK3 homolog
NatC catalytic subunit
Gene namesi
Name:Naa30
Synonyms:Mak3, Nat12
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 14

Organism-specific databases

MGIiMGI:1922259. Naa30.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 364364N-alpha-acetyltransferase 30PRO_0000320033Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei39 – 391PhosphoserineCombined sources
Modified residuei54 – 541PhosphoserineCombined sources
Modified residuei192 – 1921PhosphoserineBy similarity
Modified residuei198 – 1981PhosphoserineBy similarity
Modified residuei201 – 2011PhosphoserineBy similarity
Modified residuei235 – 2351N6-acetyllysineCombined sources

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ8CES0.
MaxQBiQ8CES0.
PaxDbiQ8CES0.
PeptideAtlasiQ8CES0.
PRIDEiQ8CES0.

PTM databases

iPTMnetiQ8CES0.
PhosphoSiteiQ8CES0.

Expressioni

Gene expression databases

BgeeiENSMUSG00000036282.
CleanExiMM_NAT12.
ExpressionAtlasiQ8CES0. baseline and differential.
GenevisibleiQ8CES0. MM.

Interactioni

Subunit structurei

Component of the N-terminal acetyltransferase C (NatC) complex, which is composed of NAA35, NAA38 and NAA30.By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000041450.

Structurei

3D structure databases

ProteinModelPortaliQ8CES0.
SMRiQ8CES0. Positions 212-356.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini216 – 364149N-acetyltransferasePROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi97 – 16670Ala-richAdd
BLAST

Sequence similaritiesi

Contains 1 N-acetyltransferase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3139. Eukaryota.
COG0456. LUCA.
GeneTreeiENSGT00390000005665.
HOGENOMiHOG000196601.
HOVERGENiHBG082671.
InParanoidiQ8CES0.
KOiK00670.
PhylomeDBiQ8CES0.

Family and domain databases

Gene3Di3.40.630.30. 1 hit.
InterProiIPR016181. Acyl_CoA_acyltransferase.
IPR000182. GNAT_dom.
[Graphical view]
PfamiPF00583. Acetyltransf_1. 1 hit.
[Graphical view]
SUPFAMiSSF55729. SSF55729. 1 hit.
PROSITEiPS51186. GNAT. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8CES0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEVPPGPSS LLPPPAPAAP AAAELRCPFP AGAALACCSE DEEDDEEHEG
60 70 80 90 100
GCGSPAGGEA ATSAKARSCL RCPQLPPEQQ QQQLNGLIGP ELRHLRAAAT
110 120 130 140 150
LKSKVLSAAE AAAPDGASKV TATKGAEGHP GERPPHSVPN NARTALPGRS
160 170 180 190 200
EAAAAAAGAA SDPAAARNGL VEGTEQQEEE EMDEQVRLLS SSLTTGCSLR
210 220 230 240 250
SSQGREAEPG EDRTIRYVRY ESELQMPDIM RLITKDLSEP YSIYTYRYFI
260 270 280 290 300
HNWPQLCFLA MVGEECVGAI VCKLDMHKKM FRRGYIAMLA VDSKYRRNGI
310 320 330 340 350
GTNLVKKAIY AMVEGDCDEV VLETEITNKS ALKLYENLGF VRDKRLFRYY
360
LNGVDALRLK LWLR
Length:364
Mass (Da):39,433
Last modified:February 26, 2008 - v2
Checksum:i94625FF77A700A14
GO
Isoform 2 (identifier: Q8CES0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-229: Missing.
     230-259: MRLITKDLSEPYSIYTYRYFIHNWPQLCFL → MLPQSLLLFPLVIVQYLMAMCLHNCLFIFK

Note: No experimental confirmation available.
Show »
Length:135
Mass (Da):15,633
Checksum:iB47BE0E166B2EAA9
GO

Sequence cautioni

The sequence BAC25468 differs from that shown. Reason: Frameshift at positions 25, 54 and 58. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti362 – 3632WL → CV in BAC25468 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 229229Missing in isoform 2. 1 PublicationVSP_031582Add
BLAST
Alternative sequencei230 – 25930MRLIT…QLCFL → MLPQSLLLFPLVIVQYLMAM CLHNCLFIFK in isoform 2. 1 PublicationVSP_031583Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK015640 mRNA. Translation: BAC25468.1. Frameshift.
BC054060 mRNA. Translation: AAH54060.1.
BC158065 mRNA. Translation: AAI58066.1.
RefSeqiNP_081768.2. NM_027492.2. [Q8CES0-1]
UniGeneiMm.275688.

Genome annotation databases

EnsembliENSMUST00000153488; ENSMUSP00000121679; ENSMUSG00000036282. [Q8CES0-1]
GeneIDi70646.
KEGGimmu:70646.
UCSCiuc007tkc.1. mouse. [Q8CES0-1]
uc007tkd.1. mouse. [Q8CES0-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK015640 mRNA. Translation: BAC25468.1. Frameshift.
BC054060 mRNA. Translation: AAH54060.1.
BC158065 mRNA. Translation: AAI58066.1.
RefSeqiNP_081768.2. NM_027492.2. [Q8CES0-1]
UniGeneiMm.275688.

3D structure databases

ProteinModelPortaliQ8CES0.
SMRiQ8CES0. Positions 212-356.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000041450.

PTM databases

iPTMnetiQ8CES0.
PhosphoSiteiQ8CES0.

Proteomic databases

EPDiQ8CES0.
MaxQBiQ8CES0.
PaxDbiQ8CES0.
PeptideAtlasiQ8CES0.
PRIDEiQ8CES0.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000153488; ENSMUSP00000121679; ENSMUSG00000036282. [Q8CES0-1]
GeneIDi70646.
KEGGimmu:70646.
UCSCiuc007tkc.1. mouse. [Q8CES0-1]
uc007tkd.1. mouse. [Q8CES0-2]

Organism-specific databases

CTDi122830.
MGIiMGI:1922259. Naa30.

Phylogenomic databases

eggNOGiKOG3139. Eukaryota.
COG0456. LUCA.
GeneTreeiENSGT00390000005665.
HOGENOMiHOG000196601.
HOVERGENiHBG082671.
InParanoidiQ8CES0.
KOiK00670.
PhylomeDBiQ8CES0.

Miscellaneous databases

ChiTaRSiNaa30. mouse.
PROiQ8CES0.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000036282.
CleanExiMM_NAT12.
ExpressionAtlasiQ8CES0. baseline and differential.
GenevisibleiQ8CES0. MM.

Family and domain databases

Gene3Di3.40.630.30. 1 hit.
InterProiIPR016181. Acyl_CoA_acyltransferase.
IPR000182. GNAT_dom.
[Graphical view]
PfamiPF00583. Acetyltransf_1. 1 hit.
[Graphical view]
SUPFAMiSSF55729. SSF55729. 1 hit.
PROSITEiPS51186. GNAT. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNAA30_MOUSE
AccessioniPrimary (citable) accession number: Q8CES0
Secondary accession number(s): B2RY23, Q7TN07
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: September 7, 2016
This is version 96 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.