Reviewed,
UniProtKB/Swiss-Prot Q8CE90 (MP2K7_MOUSE)
Last modified
February 9, 2010.
Version 66.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Dual specificity mitogen-activated protein kinase kinase 7 Short name=MAP kinase kinase 7 Short name=MAPKK 7 EC=2.7.12.2 Alternative name(s): MAPK/ERK kinase 7 Short name=MEK 7 JNK-activating kinase 2 c-Jun N-terminal kinase kinase 2 Short name=JNK kinase 2 Short name=JNKK 2 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 535 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Stress activated, dual specificity kinase that activates the JUN kinases MAPK8/JNK1, MAPK9/JNK2 and MAPK10/JNK3. Ref.1 Ref.2 Ref.3 Ref.4 Ref.5 |
| Catalytic activity | |
| Cofactor | |
| Enzyme regulation | Activated by phosphorylation by specific MAP kinase kinase kinases such as MAP3K1/MEKK1, MAP3K3/MEKK3, MAP3K11/MLK3 and MAP3K12/DLK. Isoforms 3 and 4 have lower basal activity but a higher level of inducible activation, than isoforms 2, 6, 7 and 8. Ref.5 |
| Subcellular location | |
| Tissue specificity | Expressed at high levels in brain, lung, liver, skeletal muscle, kidney, and testis and at lower levels in the heart and spleen. Ref.1 Ref.2 Ref.4 |
| Developmental stage | Expressed at high levels in the brain, spinal cord, eyes, muscle, lungs, vertebrae, and intestine and at lower levels in the heart and livers at E12.5. At later stages of embryogenesis (E14.5, E16.5, and E18.5) high levels were found in the brain, retina, bone marrow, skin, intestine, lung epithelium and the epithelial layers lining the olfactory cavity and developing teeth and whiskers. Ref.1 |
| Post-translational modification | Phosphorylated on Ser/Thr residues. Ref.5 |
| Sequence similarities | Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily. Contains 1 protein kinase domain. |
Ontologies
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 Ref.6 (identifier: Q8CE90-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 2 Ref.2 Ref.5 Ref.6 (identifier: Q8CE90-2) Also known as: a; beta 1; The sequence of this isoform differs from the canonical sequence as follows: 42-58: IIVITLSPAPAPSQRAA → T 435-435: S → R 436-535: Missing. | ||||||
| Isoform 3 Ref.3 Ref.5 (identifier: Q8CE90-3) Also known as: alpha 2; The sequence of this isoform differs from the canonical sequence as follows: 1-89: Missing. 436-519: TSVTWGAWPL...CPGASTWGLP → GSLEESPTSPPSPKSFPLSPAIPQAQAEWVSGR 520-535: Missing. | ||||||
| Isoform 4 Ref.5 (identifier: Q8CE90-4) Also known as: alpha 1; The sequence of this isoform differs from the canonical sequence as follows: 1-89: Missing. 435-435: S → R 436-535: Missing. | ||||||
| Isoform 5 Ref.2 (identifier: Q8CE90-5) Also known as: b; The sequence of this isoform differs from the canonical sequence as follows: 1-45: Missing. 46-57: TLSPAPAPSQRA → MLTPFMPLVFNSP 435-435: S → R 436-535: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 Ref.1 Ref.5 Ref.7 (identifier: Q8CE90-6) Also known as: b; gamma 1; The sequence of this isoform differs from the canonical sequence as follows: 435-435: S → R 436-535: Missing. | ||||||
| Isoform 7 Ref.5 (identifier: Q8CE90-7) Also known as: gamma 2; The sequence of this isoform differs from the canonical sequence as follows: 436-519: TSVTWGAWPL...CPGASTWGLP → GSLEESPTSPPSPKSFPLSPAIPQAQAEWVSGR 520-535: Missing. | ||||||
| Isoform 8 Ref.5 (identifier: Q8CE90-8) Also known as: beta 2; The sequence of this isoform differs from the canonical sequence as follows: 42-58: IIVITLSPAPAPSQRAA → T 436-519: TSVTWGAWPL...CPGASTWGLP → GSLEESPTSPPSPKSFPLSPAIPQAQAEWVSGR 520-535: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | ||||||
| Chain | 2 – 535 | 534 | Dual specificity mitogen-activated protein kinase kinase 7 | PRO_0000271406 | |||||
Regions | |||||||||
| Domain | 136 – 396 | 261 | Protein kinase | ||||||
| Nucleotide binding | 142 – 150 | 9 | ATP By similarity UniProtKB Q13131 | ||||||
| Coiled coil | 2 – 30 | 29 | Potential | ||||||
Sites | |||||||||
| Active site | 259 | 1 | Proton acceptor By similarity UniProtKB Q13131 | ||||||
| Binding site | 165 | 1 | ATP By similarity UniProtKB Q13131 | ||||||
| Site | 60 – 61 | 2 | Cleavage; by anthrax lethal factor By similarity UniProtKB O14733 | ||||||
| Site | 92 – 93 | 2 | Cleavage; by anthrax lethal factor By similarity UniProtKB O14733 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylalanine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 89 | 89 | Missing in isoform 3 and isoform 4. Ref.3 Ref.5 | VSP_052265 | |||||
| Alternative sequence | 1 – 45 | 45 | Missing in isoform 5. Ref.2 | VSP_052264 | |||||
| Alternative sequence | 42 – 58 | 17 | IIVIT…SQRAA → T in isoform 2 and isoform 8. Ref.2 Ref.5 Ref.6 | VSP_052266 | |||||
| Alternative sequence | 46 – 57 | 12 | TLSPA…PSQRA → MLTPFMPLVFNSP in isoform 5. Ref.2 | VSP_052267 | |||||
| Alternative sequence | 435 | 1 | S → R in isoform 2, isoform 4, isoform 5 and isoform 6. Ref.1 Ref.2 Ref.5 Ref.6 Ref.7 | VSP_052268 | |||||
| Alternative sequence | 436 – 535 | 100 | Missing in isoform 2, isoform 4, isoform 5 and isoform 6. Ref.1 Ref.2 Ref.5 Ref.6 Ref.7 | VSP_052269 | |||||
| Alternative sequence | 436 – 519 | 84 | TSVTW…TWGLP → GSLEESPTSPPSPKSFPLSP AIPQAQAEWVSGR in isoform 3, isoform 7 and isoform 8. Ref.3 Ref.5 | VSP_052270 | |||||
| Alternative sequence | 520 – 535 | 16 | Missing in isoform 3, isoform 7 and isoform 8. Ref.3 Ref.5 | VSP_052271 | |||||
Experimental info | |||||||||
| Sequence conflict | 47 | 1 | L → T in AAB63448. Ref.5 | ||||||
| Sequence conflict | 166 | 1 | Q → K in BAC27272. Ref.6 | ||||||
| Sequence conflict | 211 | 1 | A → V in AAC16274. Ref.4 | ||||||
| Sequence conflict | 217 | 1 | T → I in AAB81848. Ref.1 | ||||||
| Sequence conflict | 396 | 1 | I → II in AAD15819. Ref.5 | ||||||
| Sequence conflict | 396 | 1 | I → II in AAD15821. Ref.5 | ||||||
| Sequence conflict | 396 | 1 | I → II in AAD15823. Ref.5 | ||||||
| Sequence conflict | 418 | 1 | E → D in AAB81848. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Activation of stress-activated protein kinases/c-Jun N-terminal protein kinases (SAPKs/JNKs) by a novel mitogen-activated protein kinase kinase (MKK7)." Yao Z., Diener K., Wang X.S., Zukowski M., Matsumoto G., Zhou G., Mo R., Sasaki T., Nishina H., Hui C.C., Tan T.-H., Woodgett J.P., Penninger J.M. J. Biol. Chem. 272:32378-32383(1997) [PubMed: 9405446] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6), FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. |
| [2] | "MKK7 is a stress-activated mitogen-activated protein kinase kinase functionally related to hemipterous." Holland P.M., Magali S., Campbell J.S., Noselli S., Cooper J.A. J. Biol. Chem. 272:24994-24998(1997) [PubMed: 9312105] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 5), FUNCTION, TISSUE SPECIFICITY. |
| [3] | "A novel SAPK/JNK kinase, MKK7, stimulated by TNFalpha and cellular stresses." Moriguchi T., Toyoshima F., Masuyama N., Hanafusa H., Gotoh Y., Nishida E. EMBO J. 16:7045-7053(1997) [PubMed: 9384583] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7), FUNCTION. |
| [4] | "Human mitogen-activated protein kinase kinase 7 (MKK7) is a highly conserved c-Jun N-terminal kinase/stress-activated protein kinase (JNK/SAPK) activated by environmental stresses and physiological stimuli." Foltz I.N., Gerl R.E., Wieler J.S., Luckach M., Salmon R.A., Schrader J.W. J. Biol. Chem. 273:9344-9351(1998) [PubMed: 9535930] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-311 (ISOFORMS 2/6), FUNCTION, TISSUE SPECIFICITY. Tissue: B-cell and Thymus. |
| [5] | "The MKK7 gene encodes a group of c-Jun NH2-terminal kinase kinases." Tournier C., Whitmarsh A.J., Cavanagh J., Barrett T., Davis R.J. Mol. Cell. Biol. 19:1569-1581(1999) [PubMed: 9891090] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3; 4; 6; 7 AND 8), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 47-535 (ISOFORM 6), FUNCTION, ENZYME REGULATION, PHOSPHORYLATION, SUBCELLULAR LOCATION. Strain: CD-1. Tissue: Testis. |
| [6] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Strain: C57BL/6J. Tissue: Fetal forelimb, Fetus and Skin. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6). Strain: C57BL/6. Tissue: Eye. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF026216 mRNA. Translation: AAB81848.1. U74463 mRNA. Translation: AAC53364.1. U74464 mRNA. Translation: AAC53365.1. AB005654 mRNA. Translation: BAA24383.1. AF022112 mRNA. Translation: AAC16274.1. AF022113 mRNA. Translation: AAC16275.1. U93030 mRNA. Translation: AAB63447.1. U93031 Genomic DNA. Translation: AAB63448.1. AF060943 mRNA. Translation: AAD15819.1. AF060944 mRNA. Translation: AAD15820.1. AF060945 mRNA. Translation: AAD15821.1. AF060946 mRNA. Translation: AAD15822.1. AF060947 mRNA. Translation: AAD15823.1. AK028772 mRNA. Translation: BAC26111.1. AK031137 mRNA. Translation: BAC27272.1. AK165184 mRNA. Translation: BAE38066.1. BC070467 mRNA. Translation: AAH70467.1. |
| IPI | IPI00117840. IPI00228989. IPI00280475. IPI00749972. IPI00816840. IPI00816864. IPI00816890. IPI00816911. |
| RefSeq | NP_001036022.1. NP_001157644.1. NP_036074.2. |
| UniGene | Mm.3906 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1S9I based on UniProtKB P36507. |
| SMR | Q8CE90. Positions 119-418. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q8CE90. |
PTM databases | |
| PhosphoSite | Q8CE90. |
Proteomic databases | |
| PRIDE | Q8CE90. |
Genome annotation databases | |
| Ensembl | ENSMUST00000003027; ENSMUSP00000003027; ENSMUSG00000002948; Mus musculus. [Genome view] ENSMUST00000052385; ENSMUSP00000050752; ENSMUSG00000002948; Mus musculus. [Genome view] ENSMUST00000110998; ENSMUSP00000106626; ENSMUSG00000002948; Mus musculus. [Genome view] |
| GeneID | 26400. |
| KEGG | mmu:26400. |
| UCSC | uc009kti.1. mouse. uc009ktj.1. mouse. uc009ktk.1. mouse. uc009ktm.1. mouse. uc009ktn.1. mouse. |
Organism-specific databases | |
| CTD | 26400. |
| MGI | MGI:1346871. Map2k7. |
Phylogenomic databases | |
| eggNOG | roNOG15478. |
| HOVERGEN | Q8CE90. |
| InParanoid | Q8CE90. |
| OMA | GVLSQPH. |
| PhylomeDB | Q8CE90. |
Enzyme and pathway databases | |
| BRENDA | 2.7.12.2. 244. |
Gene expression databases | |
| ArrayExpress | Q8CE90. |
| Bgee | Q8CE90. |
| CleanEx | MM_MAP2K7. |
| Genevestigator | Q8CE90. |
Family and domain databases | |
| InterPro | IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017442. Se/Thr_prot_kinase-like_dom. IPR008271. Ser/Thr_prot_kinase_AS. IPR002290. Ser/Thr_prot_kinase_dom. [Graphical view] |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. False negative. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 304359. |
| SOURCE | Search... |
Entry information
| Entry name | MP2K7_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8CE90 Secondary accession number(s): O35406 Q9R1Z6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| SIMILARITY comments Index of protein domains and families |

Clusters with


