Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclin-D-binding Myb-like transcription factor 1

Gene

Dmtf1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Transcriptional activator which activates the CDKN2A/ARF locus in response to Ras-Raf signaling, thereby promoting p53/TP53-dependent growth arrest. May also cooperate with MYB to activate transcription of the ANPEP gene. Binds to the consensus sequence 5'-CCCG[GT]ATGT-3'.8 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi306 – 32924H-T-H motifPROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Cell cycle, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-D-binding Myb-like transcription factor 1
Alternative name(s):
Cyclin-D-interacting Myb-like protein 1
Short name:
mDmp1
Gene namesi
Name:Dmtf1
Synonyms:Dmp1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:1344415. Dmtf1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Disruption phenotypei

Mice spontaneously develop tumors with a mean latency around 80 weeks. The most common tumor types are pulmonary adenomas, adenocarcinomas, hepatocellular tumors, B-cell lymphomas and vascular tumors. The protein appears to be haplo-insufficient for tumor suppression, as heterozygous animals are also prone to spontaneous tumor development. Mice lacking this protein also exhibit enhanced susceptibility to tumor induction by activated Ras or the application of dimethylbenzanthracene (DMBA) or ionizing radiation. Early passage murine embryonic fibroblasts (MEFs) from animals lacking this protein are susceptible to transformation by activated Ras alone due to functional inactivation of the ARF-p53 pathway. Late passage MEFs from animals lacking this protein escape senescence without disrupting CDKN2A/ARF or p53 function.3 Publications

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi319 – 3191K → E: Abrogates DNA-binding. 2 Publications

Keywords - Diseasei

Tumor suppressor

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 761761Cyclin-D-binding Myb-like transcription factor 1PRO_0000323730Add
BLAST

Post-translational modificationi

Phosphorylated by the cyclin-D2/CDK4, cyclin-D3/CDK4 and cyclin-D2/CDK6 complexes and to a lesser extent by the cyclin-D1/CDK4 complex.2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8CE22.
PaxDbiQ8CE22.
PRIDEiQ8CE22.

PTM databases

iPTMnetiQ8CE22.
PhosphoSiteiQ8CE22.

Expressioni

Tissue specificityi

Ubiquitously expressed (at mRNA level). Expressed in brain, intestine, kidney, lung, pancreas, skin, spleen and tongue (at protein level). Expressed at high levels in testis and thymus (at protein level). In all tissues examined, expression is predominant in non-proliferating and differentiated cell types. These include epithelial, interstitial and smooth muscle cells of the intestine, differentiated spermatids, sperm and interstitial cells of the testis, and lymphoid cells of the medullary compartment of the thymus.3 Publications

Developmental stagei

Expressed throughout the cell cycle. Expression is highest in G0 and G1 phases and decreases during S and G2/M phases.2 Publications

Inductioni

Expression is induced by activation of the Ras-Raf signaling pathway, and this may require JUN and JUNB. Expression can be repressed by E2F1, E2F2, E2F3 and E2F4. Expression is also repressed by non-classical inhibitors of NF-kappa-B signaling such as doxorubicin, daunorubicin and UVC, and by the NF-kappa-B p65 subunit (RELA).3 Publications

Gene expression databases

BgeeiENSMUSG00000042508.
CleanExiMM_DMP1.
MM_DMTF1.
ExpressionAtlasiQ8CE22. baseline and differential.
GenevisibleiQ8CE22. MM.

Interactioni

Subunit structurei

Interacts with the D-type cyclins CCND1, CCND2 and CCND3. Interaction with D-type cyclins may modulate transcriptional activation by this protein.2 Publications

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000071815.

Structurei

3D structure databases

ProteinModelPortaliQ8CE22.
SMRiQ8CE22. Positions 220-344.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini225 – 26339Myb-like 1PROSITE-ProRule annotationAdd
BLAST
Domaini268 – 33366HTH myb-typePROSITE-ProRule annotationAdd
BLAST
Domaini339 – 38850Myb-like 2PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 237237Interaction with CCND2Add
BLAST
Regioni87 – 458372Required for DNA-bindingAdd
BLAST
Regioni87 – 17084Required for transcriptional activationAdd
BLAST
Regioni176 – 761586Interaction with CCND1, CCND2 and CCND3Add
BLAST
Regioni459 – 761303Required for transcriptional activationAdd
BLAST

Sequence similaritiesi

Belongs to the DMTF1 family.Curated
Contains 1 HTH myb-type DNA-binding domain.PROSITE-ProRule annotation
Contains 2 Myb-like domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0051. Eukaryota.
COG5147. LUCA.
GeneTreeiENSGT00530000063659.
HOVERGENiHBG053416.
InParanoidiQ8CE22.
OMAiFPDEIHQ.
OrthoDBiEOG091G03T9.
PhylomeDBiQ8CE22.
TreeFamiTF333537.

Family and domain databases

Gene3Di1.10.10.60. 2 hits.
InterProiIPR009057. Homeodomain-like.
IPR017877. Myb-like_dom.
IPR017930. Myb_dom.
IPR001005. SANT/Myb.
[Graphical view]
PfamiPF00249. Myb_DNA-binding. 2 hits.
[Graphical view]
SMARTiSM00717. SANT. 3 hits.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 3 hits.
PROSITEiPS51294. HTH_MYB. 1 hit.
PS50090. MYB_LIKE. 2 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8CE22-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSTVEEDSDT VTVETVNSVT FTQDTDGNLI LHCPQNDPDE VDSEDSTEPP
60 70 80 90 100
HKRLCLSSED DQSIDDATPC ISVVALPLSE NDQSFEVTMT ATTEVADDEL
110 120 130 140 150
SEGTVTQIQI LQNDQLDEIS PLGTEEVSAV SQAWFTTKED KDSLTNKGHK
160 170 180 190 200
WKQGMWSKEE IDILMNNIER YLKARGIKDA TEIIFEMSKD ERKDFYRTIA
210 220 230 240 250
WGLNRPLFAV YRRVLRMYDD RNHVGKYTPE EIEKLKELRI KHGNDWATIG
260 270 280 290 300
AALGRSASSV KDRCRLMKDT CNTGKWTEEE EKRLAEVVHE LTSTEPGDIV
310 320 330 340 350
TQGVSWAAVA ERVGTRSEKQ CRSKWLNYLN WKQSGGTEWT KEDEINLILR
360 370 380 390 400
IAELDVADEN DINWDLLAEG WSSVRSPQWL RSKWWTIKRQ IANHKDVSFP
410 420 430 440 450
VLIKGLKQLH ENQKNNPVLL ENKSGSGVPN SNCNSSVQHV QIRVARLEDN
460 470 480 490 500
TAISPSPMAA LQIPVQITHV SSTDSPAASV DSETITLNSG TLQTFEILPS
510 520 530 540 550
FHLQPTGTPG TYLLQTSSSQ GLPLTLTTNP TVTLAAAAPA SPEQIIVHAL
560 570 580 590 600
SPEHLLNTSD NVTVQCHTPR VIIQTVATED ITSSLSQEEL TVDSDLHSSD
610 620 630 640 650
FPEPPDALEA DTFPDEIPRP KMTIQPSFNN AHVSKFSDQN STELMNSVMV
660 670 680 690 700
RTEEEIADTD LKQEEPPSDL ASAYVTEDLE SPTIVHQVHQ TIDDETILIV
710 720 730 740 750
PSPHGFIQAS DVIDTESVLP LTTLTDPIFQ HHQEASNIIG SSLGSPVSED
760
SKDVEDLVNC H
Length:761
Mass (Da):84,644
Last modified:March 18, 2008 - v2
Checksum:iDB93810B0991CBE3
GO
Isoform 2 (identifier: Q8CE22-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     401-471: VLIKGLKQLHENQKNNPVLLENKSGSGVPNSNCNSSVQHVQIRVARLEDNTAISPSPMAALQIPVQITHVS → A

Show »
Length:691
Mass (Da):77,069
Checksum:i8798975155B11AD0
GO
Isoform 3 (identifier: Q8CE22-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     401-471: VLIKGLKQLHENQKNNPVLLENKSGSGVPNSNCNSSVQHVQIRVARLEDNTAISPSPMAALQIPVQITHVS → A
     500-524: SFHLQPTGTPGTYLLQTSSSQGLPL → KRKLLLLHLVMGTRGHALMVMEVKG
     525-761: Missing.

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:454
Mass (Da):51,513
Checksum:i1CF4652EE6E38750
GO
Isoform 4 (identifier: Q8CE22-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     37-78: DPDEVDSEDSTEPPHKRLCLSSEDDQSIDDATPCISVVALPL → V
     402-451: LIKGLKQLHE...IRVARLEDNT → YSMFRSESPA...LLLLTQKQSH
     452-761: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:410
Mass (Da):47,310
Checksum:i5736F20A28015B9D
GO
Isoform 5 (identifier: Q8CE22-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     238-273: LRIKHGNDWATIGAALGRSASSVKDRCRLMKDTCNT → QLWTPHNKGHTFKLWLSKVLLPTTCQPVRREKKNEE
     274-761: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:273
Mass (Da):31,373
Checksum:i512AFEFAC9C0D5A5
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti44 – 441E → Q in BAC30386 (PubMed:16141072).Curated
Sequence conflicti73 – 731V → F in BAC30386 (PubMed:16141072).Curated
Sequence conflicti80 – 801E → Q in BAC30386 (PubMed:16141072).Curated
Sequence conflicti180 – 1801A → G in BAC26325 (PubMed:16141072).Curated
Sequence conflicti480 – 4801V → A in AAC52878 (PubMed:8887674).Curated
Sequence conflicti502 – 5021H → P in AAC52878 (PubMed:8887674).Curated
Sequence conflicti532 – 5321V → L in AAC52878 (PubMed:8887674).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei37 – 7842DPDEV…VALPL → V in isoform 4. 2 PublicationsVSP_032094Add
BLAST
Alternative sequencei238 – 27336LRIKH…DTCNT → QLWTPHNKGHTFKLWLSKVL LPTTCQPVRREKKNEE in isoform 5. 1 PublicationVSP_032095Add
BLAST
Alternative sequencei274 – 761488Missing in isoform 5. 1 PublicationVSP_032096Add
BLAST
Alternative sequencei401 – 47171VLIKG…ITHVS → A in isoform 2 and isoform 3. 1 PublicationVSP_032097Add
BLAST
Alternative sequencei402 – 45150LIKGL…LEDNT → YSMFRSESPAWKIIQPSLQA PWQRCRFQSRSPTSLQQTPL LLLLTQKQSH in isoform 4. 2 PublicationsVSP_032098Add
BLAST
Alternative sequencei452 – 761310Missing in isoform 4. 2 PublicationsVSP_032099Add
BLAST
Alternative sequencei500 – 52425SFHLQ…QGLPL → KRKLLLLHLVMGTRGHALMV MEVKG in isoform 3. 1 PublicationVSP_032100Add
BLAST
Alternative sequencei525 – 761237Missing in isoform 3. 1 PublicationVSP_032101Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U70017 mRNA. Translation: AAC52878.1.
AK029147 mRNA. Translation: BAC26325.1.
AK031887 mRNA. Translation: BAC27593.1.
AK039563 mRNA. Translation: BAC30386.1.
AK046201 mRNA. Translation: BAC32635.1.
AK160595 mRNA. Translation: BAE35902.1.
BC045141 mRNA. Translation: AAH45141.1.
CCDSiCCDS19088.1. [Q8CE22-1]
CCDS51412.1. [Q8CE22-2]
RefSeqiNP_001103797.1. NM_001110327.1. [Q8CE22-2]
NP_035936.3. NM_011806.3. [Q8CE22-1]
XP_006503638.1. XM_006503575.2. [Q8CE22-3]
XP_011238970.1. XM_011240668.1. [Q8CE22-1]
UniGeneiMm.22480.

Genome annotation databases

EnsembliENSMUST00000071921; ENSMUSP00000071815; ENSMUSG00000042508. [Q8CE22-1]
ENSMUST00000095017; ENSMUSP00000092627; ENSMUSG00000042508. [Q8CE22-2]
ENSMUST00000183448; ENSMUSP00000139042; ENSMUSG00000042508. [Q8CE22-5]
ENSMUST00000184159; ENSMUSP00000139231; ENSMUSG00000042508. [Q8CE22-4]
ENSMUST00000184401; ENSMUSP00000139281; ENSMUSG00000042508. [Q8CE22-5]
ENSMUST00000184888; ENSMUSP00000139164; ENSMUSG00000042508. [Q8CE22-5]
GeneIDi23857.
KEGGimmu:23857.
UCSCiuc008wky.2. mouse. [Q8CE22-1]
uc008wkz.2. mouse. [Q8CE22-2]
uc008wld.2. mouse. [Q8CE22-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U70017 mRNA. Translation: AAC52878.1.
AK029147 mRNA. Translation: BAC26325.1.
AK031887 mRNA. Translation: BAC27593.1.
AK039563 mRNA. Translation: BAC30386.1.
AK046201 mRNA. Translation: BAC32635.1.
AK160595 mRNA. Translation: BAE35902.1.
BC045141 mRNA. Translation: AAH45141.1.
CCDSiCCDS19088.1. [Q8CE22-1]
CCDS51412.1. [Q8CE22-2]
RefSeqiNP_001103797.1. NM_001110327.1. [Q8CE22-2]
NP_035936.3. NM_011806.3. [Q8CE22-1]
XP_006503638.1. XM_006503575.2. [Q8CE22-3]
XP_011238970.1. XM_011240668.1. [Q8CE22-1]
UniGeneiMm.22480.

3D structure databases

ProteinModelPortaliQ8CE22.
SMRiQ8CE22. Positions 220-344.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000071815.

PTM databases

iPTMnetiQ8CE22.
PhosphoSiteiQ8CE22.

Proteomic databases

MaxQBiQ8CE22.
PaxDbiQ8CE22.
PRIDEiQ8CE22.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000071921; ENSMUSP00000071815; ENSMUSG00000042508. [Q8CE22-1]
ENSMUST00000095017; ENSMUSP00000092627; ENSMUSG00000042508. [Q8CE22-2]
ENSMUST00000183448; ENSMUSP00000139042; ENSMUSG00000042508. [Q8CE22-5]
ENSMUST00000184159; ENSMUSP00000139231; ENSMUSG00000042508. [Q8CE22-4]
ENSMUST00000184401; ENSMUSP00000139281; ENSMUSG00000042508. [Q8CE22-5]
ENSMUST00000184888; ENSMUSP00000139164; ENSMUSG00000042508. [Q8CE22-5]
GeneIDi23857.
KEGGimmu:23857.
UCSCiuc008wky.2. mouse. [Q8CE22-1]
uc008wkz.2. mouse. [Q8CE22-2]
uc008wld.2. mouse. [Q8CE22-3]

Organism-specific databases

CTDi9988.
MGIiMGI:1344415. Dmtf1.

Phylogenomic databases

eggNOGiKOG0051. Eukaryota.
COG5147. LUCA.
GeneTreeiENSGT00530000063659.
HOVERGENiHBG053416.
InParanoidiQ8CE22.
OMAiFPDEIHQ.
OrthoDBiEOG091G03T9.
PhylomeDBiQ8CE22.
TreeFamiTF333537.

Miscellaneous databases

ChiTaRSiDmtf1. mouse.
PROiQ8CE22.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000042508.
CleanExiMM_DMP1.
MM_DMTF1.
ExpressionAtlasiQ8CE22. baseline and differential.
GenevisibleiQ8CE22. MM.

Family and domain databases

Gene3Di1.10.10.60. 2 hits.
InterProiIPR009057. Homeodomain-like.
IPR017877. Myb-like_dom.
IPR017930. Myb_dom.
IPR001005. SANT/Myb.
[Graphical view]
PfamiPF00249. Myb_DNA-binding. 2 hits.
[Graphical view]
SMARTiSM00717. SANT. 3 hits.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 3 hits.
PROSITEiPS51294. HTH_MYB. 1 hit.
PS50090. MYB_LIKE. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiDMTF1_MOUSE
AccessioniPrimary (citable) accession number: Q8CE22
Secondary accession number(s): P70413
, Q3TUR9, Q80VR8, Q8BQX6, Q8CA56, Q8CCZ0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 18, 2008
Last modified: September 7, 2016
This is version 134 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.