Reviewed,
UniProtKB/Swiss-Prot Q8CE08 (PPAP_MOUSE)
Last modified
November 3, 2009.
Version 44.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Prostatic acid phosphatase EC=3.1.3.2 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 381 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Catalytic activity | A phosphate monoester + H2O = an alcohol + phosphate. |
| Subunit structure | Homodimer By similarity. |
| Subcellular location | Isoform 1: Secreted By similarity. Isoform 2: Lysosome membrane; Single-pass type I membrane protein By similarity. Note: Predominantly localized in the plasma membrane but also detected in intracellular vesicles By similarity. |
| Sequence similarities | Belongs to the histidine acid phosphatase family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Lysosome Membrane Secreted |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal |
| Molecular function | Hydrolase |
| PTM | Disulfide bond Glycoprotein |
| Gene Ontology (GO) | |
| Cellular component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-SubCell lysosomeInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | acid phosphatase activity Inferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8CE08-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8CE08-2) The sequence of this isoform differs from the canonical sequence as follows: 378-381: QGRN → QVLRVILATTFCLVTGILVILLLVLIRHGPCWQRDVYRNI | ||||||
| Note: Predominantly localized in the plasma membrane but also detected in intracellular vesicles (By similarity). |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 31 | 31 | Potential | ||||||||
| Chain | 32 – 381 | 350 | Prostatic acid phosphatase | PRO_0000356293 | |||||||
Sites | |||||||||||
| Active site | 43 | 1 | Nucleophile By similarity | ||||||||
| Active site | 289 | 1 | Proton donor By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 93 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 219 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 332 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 160 ↔ 371 | By similarity | |||||||||
| Disulfide bond | 214 ↔ 312 | By similarity | |||||||||
| Disulfide bond | 346 ↔ 350 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 378 – 381 | 4 | QGRN → QVLRVILATTFCLVTGILVI LLLVLIRHGPCWQRDVYRNI in isoform 2. | VSP_036024 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 2 | 1 | R → G in AAI39827. Ref.4 | ||||||||
| Sequence conflict | 3 | 1 | A → S in BAC36318. Ref.2 | ||||||||
| Sequence conflict | 10 | 1 | R → P in AAI39827. Ref.4 | ||||||||
| Sequence conflict | 145 | 1 | V → L in BAC36318. Ref.2 | ||||||||
| Sequence conflict | 230 | 1 | A → P in BAC36318. Ref.2 | ||||||||
| Sequence conflict | 264 | 1 | N → H in BAC36318. Ref.2 | ||||||||
| Sequence conflict | 355 | 1 | F → L in BAC36318. Ref.2 | ||||||||
| Sequence conflict | 357 – 358 | 2 | EL → DV in AAF23171. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Sequence and expression of mouse prostatic acid phosphatase." Crew M.D., Chatta G.S., Borg C.D. Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Strain: C57BL/6J. Tissue: Head and Skin. |
| [3] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed: 19468303] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF210243 mRNA. Translation: AAF23171.1. AK029273 mRNA. Translation: BAC26366.1. AK076383 mRNA. Translation: BAC36318.1. CT030733 Genomic DNA. Translation: CAX15527.1. CT030733 Genomic DNA. Translation: CAX15528.1. BC139826 mRNA. Translation: AAI39827.1. | |
| IPI | IPI00135015. IPI00410945. |
| RefSeq | NP_062781.2. NP_997551.1. |
| UniGene | Mm.19941 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1RPA based on UniProtKB P20646. |
| SMR | Q8CE08. Positions 32-373. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q8CE08. |
Genome annotation databases | |
| Ensembl | ENSMUST00000062723; ENSMUSP00000059889; ENSMUSG00000032561; Mus musculus. [Genome view] ENSMUST00000112590; ENSMUSP00000108209; ENSMUSG00000032561; Mus musculus. [Genome view] |
| GeneID | 56318. |
| KEGG | mmu:56318. |
| UCSC | uc009rhl.1. mouse. uc009rhn.1. mouse. |
Organism-specific databases | |
| CTD | 56318. |
| MGI | MGI:1928480. Acpp. |
Phylogenomic databases | |
| HOVERGEN | Q8CE08. |
| OMA | VHNFTLP. |
Gene expression databases | |
| ArrayExpress | Q8CE08. |
| Bgee | Q8CE08. |
| Genevestigator | Q8CE08. |
Family and domain databases | |
| InterPro | IPR000560. Histidine_acid_Pase. [Graphical view] |
| Pfam | PF00328. Acid_phosphat_A. 1 hit. [Graphical view] |
| PROSITE | PS00616. HIS_ACID_PHOSPHAT_1. 1 hit. PS00778. HIS_ACID_PHOSPHAT_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 312276. |
| SOURCE | Search... |
Entry information
| Entry name | PPAP_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8CE08 Secondary accession number(s): A4QPG2 Q9QXH7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


