Q8CE08 (PPAP_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 64.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Prostatic acid phosphatase EC=3.1.3.2 Alternative name(s): 5'-nucleotidase Short name=5'-NT EC=3.1.3.5 Ecto-5'-nucleotidase Fluoride-resistant acid phosphatase Short name=FRAP Thiamine monophosphatase Short name=TMPase | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 381 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | A non-specific tyrosine phosphatase that dephosphorylates a diverse number of substrates under acidic conditions (pH 4-6) including alkyl, aryl, and acyl orthophosphate monoesters and phosphorylated proteins. Has lipid phosphatase activity and inactivates lysophosphatidic acid in seminal plasma By similarity. Ref.6 Isoform 2: the cellular form also has ecto-5'-nucleotidase activity in dorsal root ganglion (DRG) neurons. Generates adenosine from AMP which acts as a pain suppressor. Ref.6 |
| Catalytic activity | A phosphate monoester + H2O = an alcohol + phosphate. Ref.6 A 5'-ribonucleotide + H2O = a ribonucleoside + phosphate. Ref.6 |
| Subunit structure | Homodimer; dimer formation is required for phosphatase activity By similarity. |
| Subcellular location | Isoform 1: Secreted By similarity Ref.5. Isoform 2: Cell membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Note: Appears to shuttle between the cell membrane and intracellular vesicles. Colocalizes with FLOT1 at cell membrane and in intracellular vesicles. Colocalizes with LAMP2 on the lysosome membrane By similarity. Ref.5 |
| Tissue specificity | Isoform 1 is expressed in salivary gland, thymus and thyroid gland. Isoform 2 is widely expressed in prostate lobes, brain, kidney, liver, lung, muscle, placenta, salivary gland, spleen, thyroid and thymus. Locates to Schwann cells and fibroblasts. Expressed in peptidergic and non-peptidergic nociceptive (pain-sensing) neurons. Preferentially expressed in non-peptidergic doral root ganglia neurons. Ref.5 Ref.6 Ref.7 |
| Disruption phenotype | Null mice display greater thermal hyperalgesia (pain sensitivity) and mechanical allodynia. No thiamine monophosphatase (TMPase) activity detected in dorsal root ganglion (DRG) neurons. Ref.6 |
| Sequence similarities | Belongs to the histidine acid phosphatase family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8CE08-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8CE08-2) Also known as: TMPase; TM-PAP; cellular PAP; cPAP; The sequence of this isoform differs from the canonical sequence as follows: 378-381: QGRN → QVLRVILATTFCLVTGILVILLLVLIRHGPCWQRDVYRNI |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 31 | 31 | Potential | ||||||||
| Chain | 32 – 381 | 350 | Prostatic acid phosphatase | PRO_0000356293 | |||||||
Sites | |||||||||||
| Active site | 43 | 1 | Nucleophile By similarity | ||||||||
| Active site | 289 | 1 | Proton donor By similarity | ||||||||
| Binding site | 42 | 1 | Substrate By similarity | ||||||||
| Binding site | 46 | 1 | Substrate By similarity | ||||||||
| Binding site | 110 | 1 | Substrate By similarity | ||||||||
| Binding site | 288 | 1 | Substrate By similarity | ||||||||
| Site | 48 | 1 | Important for substrate specificity By similarity | ||||||||
| Site | 137 | 1 | Required for dimerization By similarity | ||||||||
| Site | 143 | 1 | Required for dimerization By similarity | ||||||||
| Site | 205 | 1 | Required for structural stability By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 93 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 219 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 332 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 160 ↔ 371 | By similarity | |||||||||
| Disulfide bond | 214 ↔ 312 | By similarity | |||||||||
| Disulfide bond | 346 ↔ 350 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 378 – 381 | 4 | QGRN → QVLRVILATTFCLVTGILVI LLLVLIRHGPCWQRDVYRNI in isoform 2. | VSP_036024 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 2 | 1 | R → G in AAI39827. Ref.4 | ||||||||
| Sequence conflict | 3 | 1 | A → S in BAC36318. Ref.2 | ||||||||
| Sequence conflict | 10 | 1 | R → P in AAI39827. Ref.4 | ||||||||
| Sequence conflict | 145 | 1 | V → L in BAC36318. Ref.2 | ||||||||
| Sequence conflict | 230 | 1 | A → P in BAC36318. Ref.2 | ||||||||
| Sequence conflict | 264 | 1 | N → H in BAC36318. Ref.2 | ||||||||
| Sequence conflict | 355 | 1 | F → L in BAC36318. Ref.2 | ||||||||
| Sequence conflict | 357 – 358 | 2 | EL → DV in AAF23171. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Sequence and expression of mouse prostatic acid phosphatase." Crew M.D., Chatta G.S., Borg C.D. Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Strain: C57BL/6J. Tissue: Head and Skin. |
| [3] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [5] | "Prostatic acid phosphatase is not a prostate specific target." Quintero I.B., Araujo C.L., Pulkka A.E., Wirkkala R.S., Herrala A.M., Eskelinen E.-L., Jokitalo E., Hellstroem P.A., Tuominen H.J., Hirvikoski P.P., Vihko P.T. Cancer Res. 67:6549-6554(2007) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [6] | "Prostatic acid phosphatase is an ectonucleotidase and suppresses pain by generating adenosine." Zylka M.J., Sowa N.A., Taylor-Blake B., Twomey M.A., Herrala A., Voikar V., Vihko P. Neuron 60:111-122(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION AS AN ECTONUCLEOSIDASE, DISRUPTION PHENOTYPE, ENZYME ACTIVITY, TISSUE SPECIFICITY, FUNCTION. |
| [7] | "Prostatic acid phosphatase is expressed in peptidergic and nonpeptidergic nociceptive neurons of mice and rats." Taylor-Blake B., Zylka M.J. PLoS ONE 5:E8674-E8674(2010) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF210243 mRNA. Translation: AAF23171.1. AK029273 mRNA. Translation: BAC26366.1. AK076383 mRNA. Translation: BAC36318.1. CT030733 Genomic DNA. Translation: CAX15527.1. CT030733 Genomic DNA. Translation: CAX15528.1. BC139826 mRNA. Translation: AAI39827.1. |
| IPI | IPI00135015. IPI00410945. |
| RefSeq | NP_062781.2. NM_019807.2. NP_997551.1. NM_207668.2. |
| UniGene | Mm.19941. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1RPA based on UniProtKB P20646. |
| ProteinModelPortal | Q8CE08. |
| SMR | Q8CE08. Positions 32-373. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q8CE08. |
Proteomic databases | |
| PRIDE | Q8CE08. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000062723; ENSMUSP00000059889; ENSMUSG00000032561. ENSMUST00000112590; ENSMUSP00000108209; ENSMUSG00000032561. |
| GeneID | 56318. |
| KEGG | mmu:56318. |
| UCSC | uc009rhl.1. mouse. uc009rhm.1. mouse. |
Organism-specific databases | |
| CTD | 55. |
| MGI | MGI:1928480. Acpp. |
Phylogenomic databases | |
| eggNOG | NOG85977. |
| GeneTree | ENSGT00530000062956. |
| HOGENOM | HOG000231439. |
| HOVERGEN | HBG002203. |
| InParanoid | Q8C682. |
| KO | K14410. |
| OMA | FTLPSWA. |
Gene expression databases | |
| Bgee | Q8CE08. |
| Genevestigator | Q8CE08. |
Family and domain databases | |
| InterPro | IPR000560. His_Pase_superF_clade-2. [Graphical view] |
| Pfam | PF00328. His_Phos_2. 1 hit. [Graphical view] |
| PROSITE | PS00616. HIS_ACID_PHOSPHAT_1. 1 hit. PS00778. HIS_ACID_PHOSPHAT_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 312276. |
| SOURCE | Search... |
Entry information
| Entry name | PPAP_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8CE08 Secondary accession number(s): A4QPG2 Q9QXH7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
