Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8CE08

- PPAP_MOUSE

UniProt

Q8CE08 - PPAP_MOUSE

Protein

Prostatic acid phosphatase

Gene

Acpp

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 76 (01 Oct 2014)
      Sequence version 1 (01 Mar 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    A non-specific tyrosine phosphatase that dephosphorylates a diverse number of substrates under acidic conditions (pH 4-6) including alkyl, aryl, and acyl orthophosphate monoesters and phosphorylated proteins. Has lipid phosphatase activity and inactivates lysophosphatidic acid in seminal plasma By similarity.By similarity
    Isoform 2: the cellular form also has ecto-5'-nucleotidase activity in dorsal root ganglion (DRG) neurons. Generates adenosine from AMP which acts as a pain suppressor.1 Publication

    Catalytic activityi

    A phosphate monoester + H2O = an alcohol + phosphate.1 Publication
    A 5'-ribonucleotide + H2O = a ribonucleoside + phosphate.1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei42 – 421SubstrateBy similarity
    Active sitei43 – 431NucleophileBy similarity
    Binding sitei46 – 461SubstrateBy similarity
    Sitei48 – 481Important for substrate specificityBy similarity
    Binding sitei110 – 1101SubstrateBy similarity
    Sitei137 – 1371Required for dimerizationBy similarity
    Sitei143 – 1431Required for dimerizationBy similarity
    Sitei205 – 2051Required for structural stabilityBy similarity
    Binding sitei288 – 2881SubstrateBy similarity
    Active sitei289 – 2891Proton donorBy similarity

    GO - Molecular functioni

    1. 5'-nucleotidase activity Source: UniProt
    2. acid phosphatase activity Source: UniProt
    3. choline binding Source: Ensembl
    4. lysophosphatidic acid phosphatase activity Source: UniProt
    5. phosphatase activity Source: UniProt
    6. thiamine phosphate phosphatase activity Source: UniProt

    GO - Biological processi

    1. adenosine metabolic process Source: UniProtKB
    2. dephosphorylation Source: UniProt
    3. nucleotide metabolic process Source: UniProtKB
    4. positive regulation of adenosine receptor signaling pathway Source: UniProt
    5. purine nucleobase metabolic process Source: UniProtKB
    6. regulation of sensory perception of pain Source: UniProt
    7. thiamine metabolic process Source: UniProt

    Keywords - Molecular functioni

    Hydrolase

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Prostatic acid phosphatase (EC:3.1.3.2)
    Alternative name(s):
    5'-nucleotidase (EC:3.1.3.5)
    Short name:
    5'-NT
    Ecto-5'-nucleotidase
    Fluoride-resistant acid phosphatase
    Short name:
    FRAP
    Thiamine monophosphatase
    Short name:
    TMPase
    Gene namesi
    Name:Acpp
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 9

    Organism-specific databases

    MGIiMGI:1928480. Acpp.

    Subcellular locationi

    Isoform 1 : Secreted By similarity
    Isoform 2 : Cell membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein
    Note: Appears to shuttle between the cell membrane and intracellular vesicles. Colocalizes with FLOT1 at cell membrane and in intracellular vesicles. Colocalizes with LAMP2 on the lysosome membrane By similarity.By similarity

    GO - Cellular componenti

    1. apical part of cell Source: Ensembl
    2. extracellular space Source: UniProt
    3. filopodium Source: UniProtKB
    4. Golgi cisterna Source: Ensembl
    5. integral component of membrane Source: UniProtKB
    6. lysosomal membrane Source: UniProtKB-SubCell
    7. multivesicular body Source: Ensembl
    8. plasma membrane Source: UniProtKB
    9. secretory granule Source: Ensembl
    10. vesicle membrane Source: UniProt

    Keywords - Cellular componenti

    Cell membrane, Lysosome, Membrane, Secreted

    Pathology & Biotechi

    Disruption phenotypei

    Null mice display greater thermal hyperalgesia (pain sensitivity) and mechanical allodynia. No thiamine monophosphatase (TMPase) activity detected in dorsal root ganglion (DRG) neurons.1 Publication

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 3131Sequence AnalysisAdd
    BLAST
    Chaini32 – 381350Prostatic acid phosphatasePRO_0000356293Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi93 – 931N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi160 ↔ 371By similarity
    Disulfide bondi214 ↔ 312By similarity
    Glycosylationi219 – 2191N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi332 – 3321N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi346 ↔ 350By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PRIDEiQ8CE08.

    PTM databases

    PhosphoSiteiQ8CE08.

    Expressioni

    Tissue specificityi

    Isoform 1 is expressed in salivary gland, thymus and thyroid gland. Isoform 2 is widely expressed in prostate lobes, brain, kidney, liver, lung, muscle, placenta, salivary gland, spleen, thyroid and thymus. Locates to Schwann cells and fibroblasts. Expressed in peptidergic and non-peptidergic nociceptive (pain-sensing) neurons. Preferentially expressed in non-peptidergic doral root ganglia neurons.3 Publications

    Gene expression databases

    BgeeiQ8CE08.
    GenevestigatoriQ8CE08.

    Interactioni

    Subunit structurei

    Homodimer; dimer formation is required for phosphatase activity.By similarity

    Structurei

    3D structure databases

    ProteinModelPortaliQ8CE08.
    SMRiQ8CE08. Positions 32-373.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the histidine acid phosphatase family.Curated

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG85977.
    GeneTreeiENSGT00530000062956.
    HOGENOMiHOG000231439.
    HOVERGENiHBG002203.
    InParanoidiQ8C682.
    KOiK14410.
    OMAiFTLPSWA.
    OrthoDBiEOG7GXPBJ.
    TreeFamiTF312893.

    Family and domain databases

    Gene3Di3.40.50.1240. 1 hit.
    InterProiIPR000560. His_Pase_superF_clade-2.
    IPR029033. His_PPase_superfam.
    [Graphical view]
    PfamiPF00328. His_Phos_2. 1 hit.
    [Graphical view]
    SUPFAMiSSF53254. SSF53254. 1 hit.
    PROSITEiPS00616. HIS_ACID_PHOSPHAT_1. 1 hit.
    PS00778. HIS_ACID_PHOSPHAT_2. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8CE08-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRAVPLPLSR TASLSLGFLL LLSLCLDPGQ AKELKFVTLV FRHGDRGPIE    50
    TFPTDPITES SWPQGFGQLT QWGMEQHYEL GSYIRKRYGR FLNDTYKHDQ 100
    IYIRSTDVDR TLMSAMTNLA ALFPPEGISI WNPRLLWQPI PVHTVSLSED 150
    RLLYLPFRDC PRFEELKSET LESEEFLKRL HPYKSFLDTL SSLSGFDDQD 200
    LFGIWSKVYD PLFCESVHNF TLPSWATEDA MIKLKELSEL SLLSLYGIHK 250
    QKEKSRLQGG VLVNEILKNM KLATQPQKYK KLVMYSAHDT TVSGLQMALD 300
    VYNGVLPPYA SCHMMELYHD KGGHFVEMYY RNETQNEPYP LTLPGCTHSC 350
    PLEKFAELLD PVISQDWATE CMATSSHQGR N 381
    Length:381
    Mass (Da):43,717
    Last modified:March 1, 2003 - v1
    Checksum:iC0077819D77CB251
    GO
    Isoform 2 (identifier: Q8CE08-2) [UniParc]FASTAAdd to Basket

    Also known as: TMPase, TM-PAP, cellular PAP, cPAP

    The sequence of this isoform differs from the canonical sequence as follows:
         378-381: QGRN → QVLRVILATTFCLVTGILVILLLVLIRHGPCWQRDVYRNI

    Show »
    Length:417
    Mass (Da):47,863
    Checksum:i505B9B551BA5CEF7
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti2 – 21R → G in AAI39827. (PubMed:15489334)Curated
    Sequence conflicti3 – 31A → S in BAC36318. (PubMed:16141072)Curated
    Sequence conflicti10 – 101R → P in AAI39827. (PubMed:15489334)Curated
    Sequence conflicti145 – 1451V → L in BAC36318. (PubMed:16141072)Curated
    Sequence conflicti230 – 2301A → P in BAC36318. (PubMed:16141072)Curated
    Sequence conflicti264 – 2641N → H in BAC36318. (PubMed:16141072)Curated
    Sequence conflicti355 – 3551F → L in BAC36318. (PubMed:16141072)Curated
    Sequence conflicti357 – 3582EL → DV in AAF23171. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei378 – 3814QGRN → QVLRVILATTFCLVTGILVI LLLVLIRHGPCWQRDVYRNI in isoform 2. 2 PublicationsVSP_036024

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF210243 mRNA. Translation: AAF23171.1.
    AK029273 mRNA. Translation: BAC26366.1.
    AK076383 mRNA. Translation: BAC36318.1.
    CT030733 Genomic DNA. Translation: CAX15527.1.
    CT030733 Genomic DNA. Translation: CAX15528.1.
    BC139826 mRNA. Translation: AAI39827.1.
    CCDSiCCDS23460.1. [Q8CE08-2]
    CCDS40750.1. [Q8CE08-1]
    RefSeqiNP_062781.2. NM_019807.2. [Q8CE08-1]
    NP_997551.1. NM_207668.2. [Q8CE08-2]
    UniGeneiMm.19941.

    Genome annotation databases

    EnsembliENSMUST00000062723; ENSMUSP00000059889; ENSMUSG00000032561. [Q8CE08-2]
    ENSMUST00000112590; ENSMUSP00000108209; ENSMUSG00000032561. [Q8CE08-1]
    GeneIDi56318.
    KEGGimmu:56318.
    UCSCiuc009rhl.1. mouse. [Q8CE08-2]
    uc009rhm.1. mouse. [Q8CE08-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF210243 mRNA. Translation: AAF23171.1 .
    AK029273 mRNA. Translation: BAC26366.1 .
    AK076383 mRNA. Translation: BAC36318.1 .
    CT030733 Genomic DNA. Translation: CAX15527.1 .
    CT030733 Genomic DNA. Translation: CAX15528.1 .
    BC139826 mRNA. Translation: AAI39827.1 .
    CCDSi CCDS23460.1. [Q8CE08-2 ]
    CCDS40750.1. [Q8CE08-1 ]
    RefSeqi NP_062781.2. NM_019807.2. [Q8CE08-1 ]
    NP_997551.1. NM_207668.2. [Q8CE08-2 ]
    UniGenei Mm.19941.

    3D structure databases

    ProteinModelPortali Q8CE08.
    SMRi Q8CE08. Positions 32-373.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei Q8CE08.

    Proteomic databases

    PRIDEi Q8CE08.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000062723 ; ENSMUSP00000059889 ; ENSMUSG00000032561 . [Q8CE08-2 ]
    ENSMUST00000112590 ; ENSMUSP00000108209 ; ENSMUSG00000032561 . [Q8CE08-1 ]
    GeneIDi 56318.
    KEGGi mmu:56318.
    UCSCi uc009rhl.1. mouse. [Q8CE08-2 ]
    uc009rhm.1. mouse. [Q8CE08-1 ]

    Organism-specific databases

    CTDi 55.
    MGIi MGI:1928480. Acpp.

    Phylogenomic databases

    eggNOGi NOG85977.
    GeneTreei ENSGT00530000062956.
    HOGENOMi HOG000231439.
    HOVERGENi HBG002203.
    InParanoidi Q8C682.
    KOi K14410.
    OMAi FTLPSWA.
    OrthoDBi EOG7GXPBJ.
    TreeFami TF312893.

    Miscellaneous databases

    NextBioi 312276.
    PROi Q8CE08.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q8CE08.
    Genevestigatori Q8CE08.

    Family and domain databases

    Gene3Di 3.40.50.1240. 1 hit.
    InterProi IPR000560. His_Pase_superF_clade-2.
    IPR029033. His_PPase_superfam.
    [Graphical view ]
    Pfami PF00328. His_Phos_2. 1 hit.
    [Graphical view ]
    SUPFAMi SSF53254. SSF53254. 1 hit.
    PROSITEi PS00616. HIS_ACID_PHOSPHAT_1. 1 hit.
    PS00778. HIS_ACID_PHOSPHAT_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Sequence and expression of mouse prostatic acid phosphatase."
      Crew M.D., Chatta G.S., Borg C.D.
      Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Strain: C57BL/6J.
      Tissue: Head and Skin.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    5. Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    6. "Prostatic acid phosphatase is an ectonucleotidase and suppresses pain by generating adenosine."
      Zylka M.J., Sowa N.A., Taylor-Blake B., Twomey M.A., Herrala A., Voikar V., Vihko P.
      Neuron 60:111-122(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION AS AN ECTONUCLEOSIDASE, DISRUPTION PHENOTYPE, ENZYME ACTIVITY, TISSUE SPECIFICITY, FUNCTION.
    7. "Prostatic acid phosphatase is expressed in peptidergic and nonpeptidergic nociceptive neurons of mice and rats."
      Taylor-Blake B., Zylka M.J.
      PLoS ONE 5:E8674-E8674(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiPPAP_MOUSE
    AccessioniPrimary (citable) accession number: Q8CE08
    Secondary accession number(s): A4QPG2
    , B8JJZ5, B8JJZ6, Q8C682, Q9QXH7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 16, 2008
    Last sequence update: March 1, 2003
    Last modified: October 1, 2014
    This is version 76 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3