Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Prostatic acid phosphatase

Gene

Acpp

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

A non-specific tyrosine phosphatase that dephosphorylates a diverse number of substrates under acidic conditions (pH 4-6) including alkyl, aryl, and acyl orthophosphate monoesters and phosphorylated proteins. Has lipid phosphatase activity and inactivates lysophosphatidic acid in seminal plasma (By similarity).By similarity
Isoform 2: the cellular form also has ecto-5'-nucleotidase activity in dorsal root ganglion (DRG) neurons. Generates adenosine from AMP which acts as a pain suppressor.1 Publication

Catalytic activityi

A phosphate monoester + H2O = an alcohol + phosphate.1 Publication
A 5'-ribonucleotide + H2O = a ribonucleoside + phosphate.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei42 – 421SubstrateBy similarity
Active sitei43 – 431NucleophileBy similarity
Binding sitei46 – 461SubstrateBy similarity
Sitei48 – 481Important for substrate specificityBy similarity
Binding sitei110 – 1101SubstrateBy similarity
Sitei137 – 1371Required for dimerizationBy similarity
Sitei143 – 1431Required for dimerizationBy similarity
Sitei205 – 2051Required for structural stabilityBy similarity
Binding sitei288 – 2881SubstrateBy similarity
Active sitei289 – 2891Proton donorBy similarity

GO - Molecular functioni

GO - Biological processi

  • adenosine metabolic process Source: UniProtKB
  • dephosphorylation Source: UniProtKB
  • nucleotide metabolic process Source: UniProtKB
  • positive regulation of adenosine receptor signaling pathway Source: UniProtKB
  • purine nucleobase metabolic process Source: UniProtKB
  • regulation of sensory perception of pain Source: UniProtKB
  • thiamine metabolic process Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Names & Taxonomyi

Protein namesi
Recommended name:
Prostatic acid phosphatase (EC:3.1.3.2)
Alternative name(s):
5'-nucleotidase (EC:3.1.3.5)
Short name:
5'-NT
Ecto-5'-nucleotidase
Fluoride-resistant acid phosphatase
Short name:
FRAP
Thiamine monophosphatase
Short name:
TMPase
Gene namesi
Name:Acpp
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:1928480. Acpp.

Subcellular locationi

Isoform 1 :
Isoform 2 :

GO - Cellular componenti

  • apical part of cell Source: Ensembl
  • extracellular exosome Source: MGI
  • extracellular space Source: UniProtKB
  • filopodium Source: UniProtKB
  • Golgi cisterna Source: Ensembl
  • integral component of membrane Source: UniProtKB
  • intracellular Source: MGI
  • lysosomal membrane Source: MGI
  • multivesicular body Source: Ensembl
  • nucleus Source: MGI
  • plasma membrane Source: UniProtKB
  • secretory granule Source: Ensembl
  • vesicle membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Lysosome, Membrane, Secreted

Pathology & Biotechi

Disruption phenotypei

Null mice display greater thermal hyperalgesia (pain sensitivity) and mechanical allodynia. No thiamine monophosphatase (TMPase) activity detected in dorsal root ganglion (DRG) neurons.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3131Sequence AnalysisAdd
BLAST
Chaini32 – 381350Prostatic acid phosphatasePRO_0000356293Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi93 – 931N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi160 ↔ 371By similarity
Disulfide bondi214 ↔ 312By similarity
Glycosylationi219 – 2191N-linked (GlcNAc...)Sequence Analysis
Glycosylationi332 – 3321N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi346 ↔ 350By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PRIDEiQ8CE08.

PTM databases

PhosphoSiteiQ8CE08.

Expressioni

Tissue specificityi

Isoform 1 is expressed in salivary gland, thymus and thyroid gland. Isoform 2 is widely expressed in prostate lobes, brain, kidney, liver, lung, muscle, placenta, salivary gland, spleen, thyroid and thymus. Locates to Schwann cells and fibroblasts. Expressed in peptidergic and non-peptidergic nociceptive (pain-sensing) neurons. Preferentially expressed in non-peptidergic doral root ganglia neurons.3 Publications

Gene expression databases

BgeeiQ8CE08.
GenevestigatoriQ8CE08.

Interactioni

Subunit structurei

Homodimer; dimer formation is required for phosphatase activity.By similarity

Structurei

3D structure databases

ProteinModelPortaliQ8CE08.
SMRiQ8CE08. Positions 32-373.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the histidine acid phosphatase family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG85977.
GeneTreeiENSGT00530000062956.
HOGENOMiHOG000231439.
HOVERGENiHBG002203.
InParanoidiQ8CE08.
KOiK14410.
OMAiFTLPSWA.
OrthoDBiEOG7GXPBJ.
TreeFamiTF312893.

Family and domain databases

Gene3Di3.40.50.1240. 1 hit.
InterProiIPR000560. His_Pase_superF_clade-2.
IPR029033. His_PPase_superfam.
[Graphical view]
PfamiPF00328. His_Phos_2. 1 hit.
[Graphical view]
SUPFAMiSSF53254. SSF53254. 1 hit.
PROSITEiPS00616. HIS_ACID_PHOSPHAT_1. 1 hit.
PS00778. HIS_ACID_PHOSPHAT_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8CE08-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRAVPLPLSR TASLSLGFLL LLSLCLDPGQ AKELKFVTLV FRHGDRGPIE
60 70 80 90 100
TFPTDPITES SWPQGFGQLT QWGMEQHYEL GSYIRKRYGR FLNDTYKHDQ
110 120 130 140 150
IYIRSTDVDR TLMSAMTNLA ALFPPEGISI WNPRLLWQPI PVHTVSLSED
160 170 180 190 200
RLLYLPFRDC PRFEELKSET LESEEFLKRL HPYKSFLDTL SSLSGFDDQD
210 220 230 240 250
LFGIWSKVYD PLFCESVHNF TLPSWATEDA MIKLKELSEL SLLSLYGIHK
260 270 280 290 300
QKEKSRLQGG VLVNEILKNM KLATQPQKYK KLVMYSAHDT TVSGLQMALD
310 320 330 340 350
VYNGVLPPYA SCHMMELYHD KGGHFVEMYY RNETQNEPYP LTLPGCTHSC
360 370 380
PLEKFAELLD PVISQDWATE CMATSSHQGR N
Length:381
Mass (Da):43,717
Last modified:March 1, 2003 - v1
Checksum:iC0077819D77CB251
GO
Isoform 2 (identifier: Q8CE08-2) [UniParc]FASTAAdd to basket

Also known as: TMPase, TM-PAP, cellular PAP, cPAP

The sequence of this isoform differs from the canonical sequence as follows:
     378-381: QGRN → QVLRVILATTFCLVTGILVILLLVLIRHGPCWQRDVYRNI

Show »
Length:417
Mass (Da):47,863
Checksum:i505B9B551BA5CEF7
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti2 – 21R → G in AAI39827 (PubMed:15489334).Curated
Sequence conflicti3 – 31A → S in BAC36318 (PubMed:16141072).Curated
Sequence conflicti10 – 101R → P in AAI39827 (PubMed:15489334).Curated
Sequence conflicti145 – 1451V → L in BAC36318 (PubMed:16141072).Curated
Sequence conflicti230 – 2301A → P in BAC36318 (PubMed:16141072).Curated
Sequence conflicti264 – 2641N → H in BAC36318 (PubMed:16141072).Curated
Sequence conflicti355 – 3551F → L in BAC36318 (PubMed:16141072).Curated
Sequence conflicti357 – 3582EL → DV in AAF23171 (Ref. 1) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei378 – 3814QGRN → QVLRVILATTFCLVTGILVI LLLVLIRHGPCWQRDVYRNI in isoform 2. 2 PublicationsVSP_036024

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF210243 mRNA. Translation: AAF23171.1.
AK029273 mRNA. Translation: BAC26366.1.
AK076383 mRNA. Translation: BAC36318.1.
CT030733 Genomic DNA. Translation: CAX15527.1.
CT030733 Genomic DNA. Translation: CAX15528.1.
BC139826 mRNA. Translation: AAI39827.1.
CCDSiCCDS23460.1. [Q8CE08-2]
CCDS40750.1. [Q8CE08-1]
RefSeqiNP_062781.2. NM_019807.2. [Q8CE08-1]
NP_997551.1. NM_207668.2. [Q8CE08-2]
UniGeneiMm.19941.

Genome annotation databases

EnsembliENSMUST00000062723; ENSMUSP00000059889; ENSMUSG00000032561. [Q8CE08-2]
ENSMUST00000112590; ENSMUSP00000108209; ENSMUSG00000032561. [Q8CE08-1]
GeneIDi56318.
KEGGimmu:56318.
UCSCiuc009rhl.1. mouse. [Q8CE08-2]
uc009rhm.1. mouse. [Q8CE08-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF210243 mRNA. Translation: AAF23171.1.
AK029273 mRNA. Translation: BAC26366.1.
AK076383 mRNA. Translation: BAC36318.1.
CT030733 Genomic DNA. Translation: CAX15527.1.
CT030733 Genomic DNA. Translation: CAX15528.1.
BC139826 mRNA. Translation: AAI39827.1.
CCDSiCCDS23460.1. [Q8CE08-2]
CCDS40750.1. [Q8CE08-1]
RefSeqiNP_062781.2. NM_019807.2. [Q8CE08-1]
NP_997551.1. NM_207668.2. [Q8CE08-2]
UniGeneiMm.19941.

3D structure databases

ProteinModelPortaliQ8CE08.
SMRiQ8CE08. Positions 32-373.
ModBaseiSearch...
MobiDBiSearch...

PTM databases

PhosphoSiteiQ8CE08.

Proteomic databases

PRIDEiQ8CE08.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000062723; ENSMUSP00000059889; ENSMUSG00000032561. [Q8CE08-2]
ENSMUST00000112590; ENSMUSP00000108209; ENSMUSG00000032561. [Q8CE08-1]
GeneIDi56318.
KEGGimmu:56318.
UCSCiuc009rhl.1. mouse. [Q8CE08-2]
uc009rhm.1. mouse. [Q8CE08-1]

Organism-specific databases

CTDi55.
MGIiMGI:1928480. Acpp.

Phylogenomic databases

eggNOGiNOG85977.
GeneTreeiENSGT00530000062956.
HOGENOMiHOG000231439.
HOVERGENiHBG002203.
InParanoidiQ8CE08.
KOiK14410.
OMAiFTLPSWA.
OrthoDBiEOG7GXPBJ.
TreeFamiTF312893.

Miscellaneous databases

NextBioi312276.
PROiQ8CE08.
SOURCEiSearch...

Gene expression databases

BgeeiQ8CE08.
GenevestigatoriQ8CE08.

Family and domain databases

Gene3Di3.40.50.1240. 1 hit.
InterProiIPR000560. His_Pase_superF_clade-2.
IPR029033. His_PPase_superfam.
[Graphical view]
PfamiPF00328. His_Phos_2. 1 hit.
[Graphical view]
SUPFAMiSSF53254. SSF53254. 1 hit.
PROSITEiPS00616. HIS_ACID_PHOSPHAT_1. 1 hit.
PS00778. HIS_ACID_PHOSPHAT_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Sequence and expression of mouse prostatic acid phosphatase."
    Crew M.D., Chatta G.S., Borg C.D.
    Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: C57BL/6J.
    Tissue: Head and Skin.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  5. Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  6. "Prostatic acid phosphatase is an ectonucleotidase and suppresses pain by generating adenosine."
    Zylka M.J., Sowa N.A., Taylor-Blake B., Twomey M.A., Herrala A., Voikar V., Vihko P.
    Neuron 60:111-122(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION AS AN ECTONUCLEOSIDASE, DISRUPTION PHENOTYPE, ENZYME ACTIVITY, TISSUE SPECIFICITY, FUNCTION.
  7. "Prostatic acid phosphatase is expressed in peptidergic and nonpeptidergic nociceptive neurons of mice and rats."
    Taylor-Blake B., Zylka M.J.
    PLoS ONE 5:E8674-E8674(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.

Entry informationi

Entry nameiPPAP_MOUSE
AccessioniPrimary (citable) accession number: Q8CE08
Secondary accession number(s): A4QPG2
, B8JJZ5, B8JJZ6, Q8C682, Q9QXH7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 16, 2008
Last sequence update: March 1, 2003
Last modified: May 27, 2015
This is version 80 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.