Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dynein regulatory complex subunit 6

Gene

Fbxl13

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Component of the nexin-dynein regulatory complex (N-DRC), a key regulator of ciliary/flagellar motility which maintains the alignment and integrity of the distal axoneme and regulates microtubule sliding in motile axonemes. Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.By similarity

GO - Molecular functioni

Keywordsi

Biological processUbl conjugation pathway

Enzyme and pathway databases

ReactomeiR-MMU-8951664 Neddylation
R-MMU-983168 Antigen processing: Ubiquitination & Proteasome degradation

Names & Taxonomyi

Protein namesi
Recommended name:
Dynein regulatory complex subunit 61 Publication
Alternative name(s):
F-box and leucine-rich repeat protein 13
F-box/LRR-repeat protein 13
Gene namesi
Name:Fbxl13
Synonyms:Drc61 Publication
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:2443416 Fbxl13

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Flagellum

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001198601 – 790Dynein regulatory complex subunit 6Add BLAST790

Proteomic databases

PaxDbiQ8CDU4
PRIDEiQ8CDU4

PTM databases

PhosphoSitePlusiQ8CDU4

Expressioni

Gene expression databases

BgeeiENSMUSG00000048520
CleanExiMM_FBXL13
ExpressionAtlasiQ8CDU4 baseline and differential

Interactioni

Subunit structurei

Component of the nexin-dynein regulatory complex (N-DRC). Directly interacts with SKP1 and CUL1 (By similarity). Interacts with TCTE1/DRC5 (PubMed:28630322).By similarity1 Publication

Protein-protein interaction databases

BioGridi235772, 1 interactor
STRINGi10090.ENSMUSP00000052716

Structurei

3D structure databases

ProteinModelPortaliQ8CDU4
SMRiQ8CDU4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini237 – 283F-boxPROSITE-ProRule annotationAdd BLAST47
Repeati503 – 525LRR 1Add BLAST23
Repeati531 – 552LRR 2Add BLAST22
Repeati557 – 579LRR 3Add BLAST23
Repeati582 – 602LRR 4Add BLAST21
Repeati606 – 628LRR 5Add BLAST23
Repeati632 – 657LRR 6Add BLAST26

Sequence similaritiesi

Belongs to the DRC6 family.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

eggNOGiENOG410IT20 Eukaryota
ENOG410XPA4 LUCA
GeneTreeiENSGT00760000119059
HOGENOMiHOG000006699
HOVERGENiHBG051673
InParanoidiQ8CDU4
KOiK10279
OMAiLAIYCIN
OrthoDBiEOG091G08EL
PhylomeDBiQ8CDU4
TreeFamiTF329711

Family and domain databases

Gene3Di3.80.10.10, 3 hits
InterProiView protein in InterPro
IPR036047 F-box-like_dom_sf
IPR001810 F-box_dom
IPR001611 Leu-rich_rpt
IPR006553 Leu-rich_rpt_Cys-con_subtyp
IPR032675 LRR_dom_sf
PfamiView protein in Pfam
PF12937 F-box-like, 1 hit
PF13516 LRR_6, 3 hits
SMARTiView protein in SMART
SM00256 FBOX, 1 hit
SM00367 LRR_CC, 14 hits
SUPFAMiSSF81383 SSF81383, 1 hit
PROSITEiView protein in PROSITE
PS50181 FBOX, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8CDU4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASLRSATPR LRSYFRDKYI PQICEALLCG LLVTCPEDPL KYLEHMILAI
60 70 80 90 100
IKRGLENLLW DTCIHPSLKS RVRRLSETYL DELFGLDDQL VTPELMIKAC
110 120 130 140 150
TFYTGHLVKT HFSGWKKVAI PRANQEEIMA EKMDKAIAHD NFRCQKYIFN
160 170 180 190 200
RWFAYTVMSR ERLITTLLRL RHLFYMQRQR IILAKWKERA RHKSKTREDD
210 220 230 240 250
LISKHELQLK KWKFKLGKPI SLEGSLSDIA VENRRIAFDI SVLPEQAILQ
260 270 280 290 300
IFLYLTFKDM MACSRVNRSW MAMIQRGSLW NSIDFSTVKN IADKCVVTTL
310 320 330 340 350
QKWRLNVLRL NFRGCDFRTK TLKAVSHCKN LQELNVSDCQ SFTDESMRHI
360 370 380 390 400
SEGCPGVLYL NLSNTTITNR TMRLLPRYFH NLQNLSLAYC RKFTDKGLQY
410 420 430 440 450
LNLGNGCHKL IYLDLSGCTQ VLVEKCPRIS SVVLIGSPHI SDSAFKALSS
460 470 480 490 500
CDLKKIRFEG NKRISDACFK SIDRNYPGIN HIYMVDCKGL TDSSLKSLSL
510 520 530 540 550
LKQLTVLNLT NCIRIGDIGL KHFFDGPASI RLRELNLTNC SLLGDSSVIR
560 570 580 590 600
LSERCPNLHY LNLRNCEHLT DLAIEYIASM LSLISVDLSG TLISNEGMTI
610 620 630 640 650
LSRHRKLREV SVSDCVNITD FGIRAYCKTS LLLEHLDVSY CSQLTDDIIK
660 670 680 690 700
TIAIFCTRIT SLNIAGCPKI TDAGMEILSA RCHYLHILDI SGCIQLTDQI
710 720 730 740 750
IQDLQIGCKQ LRILKMQFCK SISPAAAQKM SSVVQHQEYN SDNPPHWFGY
760 770 780 790
DSEGNPLDKI HSRVQLRTYS KLIVKEPFSI DEEDPDSKHQ
Note: No experimental confirmation available.
Length:790
Mass (Da):90,657
Last modified:March 15, 2005 - v2
Checksum:iE4E3C2BA2D680367
GO
Isoform 2 (identifier: Q8CDU4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     420-420: Q → QISVQGFRNIASSCTGIVHLTINDMPTLTDNCVK
     670-685: ITDAGMEILSARCHYL → VCMAAGALTGSRQGCT
     686-790: Missing.

Note: No experimental confirmation available.
Show »
Length:718
Mass (Da):81,888
Checksum:i37DE892DC15CC165
GO

Sequence cautioni

The sequence BAC26515 differs from that shown. Reason: Frameshift at position 7.Curated
The sequence BAC26821 differs from that shown. Reason: Frameshift at position 554.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti173L → W in BAC26821 (PubMed:16141072).Curated1
Sequence conflicti377R → K in BAC26515 (PubMed:16141072).Curated1
Sequence conflicti391R → E in BAC26515 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_013006420Q → QISVQGFRNIASSCTGIVHL TINDMPTLTDNCVK in isoform 2. 1 Publication1
Alternative sequenceiVSP_013007670 – 685ITDAG…RCHYL → VCMAAGALTGSRQGCT in isoform 2. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_013008686 – 790Missing in isoform 2. 1 PublicationAdd BLAST105

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK029566 mRNA Translation: BAC26515.1 Frameshift.
AK030172 mRNA Translation: BAC26821.1 Frameshift.
CCDSiCCDS51429.1 [Q8CDU4-1]
RefSeqiNP_796050.2, NM_177076.4 [Q8CDU4-1]
UniGeneiMm.442295

Genome annotation databases

EnsembliENSMUST00000051358; ENSMUSP00000052716; ENSMUSG00000048520 [Q8CDU4-1]
GeneIDi320118
KEGGimmu:320118
UCSCiuc008wop.2 mouse [Q8CDU4-1]
uc008woq.1 mouse [Q8CDU4-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiDRC6_MOUSE
AccessioniPrimary (citable) accession number: Q8CDU4
Secondary accession number(s): Q8CDE9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 15, 2005
Last sequence update: March 15, 2005
Last modified: April 25, 2018
This is version 117 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health