Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

F-box/LRR-repeat protein 13

Gene

Fbxl13

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.By similarity

Keywords - Biological processi

Ubl conjugation pathway

Enzyme and pathway databases

ReactomeiR-MMU-983168. Antigen processing: Ubiquitination & Proteasome degradation.

Names & Taxonomyi

Protein namesi
Recommended name:
F-box/LRR-repeat protein 13
Alternative name(s):
F-box and leucine-rich repeat protein 13
Gene namesi
Name:Fbxl13
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:2443416. Fbxl13.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001198601 – 790F-box/LRR-repeat protein 13Add BLAST790

Proteomic databases

PaxDbiQ8CDU4.
PRIDEiQ8CDU4.

PTM databases

PhosphoSitePlusiQ8CDU4.

Expressioni

Gene expression databases

BgeeiENSMUSG00000048520.
CleanExiMM_FBXL13.
ExpressionAtlasiQ8CDU4. baseline and differential.

Interactioni

Subunit structurei

Directly interacts with SKP1 and CUL1.By similarity

Protein-protein interaction databases

BioGridi235772. 1 interactor.
STRINGi10090.ENSMUSP00000052716.

Structurei

3D structure databases

ProteinModelPortaliQ8CDU4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini237 – 283F-boxPROSITE-ProRule annotationAdd BLAST47
Repeati503 – 525LRR 1Add BLAST23
Repeati531 – 552LRR 2Add BLAST22
Repeati557 – 579LRR 3Add BLAST23
Repeati582 – 602LRR 4Add BLAST21
Repeati606 – 628LRR 5Add BLAST23
Repeati632 – 657LRR 6Add BLAST26

Sequence similaritiesi

Contains 1 F-box domain.PROSITE-ProRule annotation
Contains 6 LRR (leucine-rich) repeats.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

eggNOGiENOG410IT20. Eukaryota.
ENOG410XPA4. LUCA.
GeneTreeiENSGT00760000119059.
HOGENOMiHOG000006699.
HOVERGENiHBG051673.
InParanoidiQ8CDU4.
KOiK10279.
OMAiPRWFGYD.
OrthoDBiEOG091G08EL.
PhylomeDBiQ8CDU4.
TreeFamiTF329711.

Family and domain databases

Gene3Di3.80.10.10. 2 hits.
InterProiIPR001810. F-box_dom.
IPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR006553. Leu-rich_rpt_Cys-con_subtyp.
[Graphical view]
PfamiPF12937. F-box-like. 1 hit.
PF13516. LRR_6. 3 hits.
[Graphical view]
SMARTiSM00256. FBOX. 1 hit.
SM00367. LRR_CC. 14 hits.
[Graphical view]
SUPFAMiSSF81383. SSF81383. 1 hit.
PROSITEiPS50181. FBOX. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8CDU4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASLRSATPR LRSYFRDKYI PQICEALLCG LLVTCPEDPL KYLEHMILAI
60 70 80 90 100
IKRGLENLLW DTCIHPSLKS RVRRLSETYL DELFGLDDQL VTPELMIKAC
110 120 130 140 150
TFYTGHLVKT HFSGWKKVAI PRANQEEIMA EKMDKAIAHD NFRCQKYIFN
160 170 180 190 200
RWFAYTVMSR ERLITTLLRL RHLFYMQRQR IILAKWKERA RHKSKTREDD
210 220 230 240 250
LISKHELQLK KWKFKLGKPI SLEGSLSDIA VENRRIAFDI SVLPEQAILQ
260 270 280 290 300
IFLYLTFKDM MACSRVNRSW MAMIQRGSLW NSIDFSTVKN IADKCVVTTL
310 320 330 340 350
QKWRLNVLRL NFRGCDFRTK TLKAVSHCKN LQELNVSDCQ SFTDESMRHI
360 370 380 390 400
SEGCPGVLYL NLSNTTITNR TMRLLPRYFH NLQNLSLAYC RKFTDKGLQY
410 420 430 440 450
LNLGNGCHKL IYLDLSGCTQ VLVEKCPRIS SVVLIGSPHI SDSAFKALSS
460 470 480 490 500
CDLKKIRFEG NKRISDACFK SIDRNYPGIN HIYMVDCKGL TDSSLKSLSL
510 520 530 540 550
LKQLTVLNLT NCIRIGDIGL KHFFDGPASI RLRELNLTNC SLLGDSSVIR
560 570 580 590 600
LSERCPNLHY LNLRNCEHLT DLAIEYIASM LSLISVDLSG TLISNEGMTI
610 620 630 640 650
LSRHRKLREV SVSDCVNITD FGIRAYCKTS LLLEHLDVSY CSQLTDDIIK
660 670 680 690 700
TIAIFCTRIT SLNIAGCPKI TDAGMEILSA RCHYLHILDI SGCIQLTDQI
710 720 730 740 750
IQDLQIGCKQ LRILKMQFCK SISPAAAQKM SSVVQHQEYN SDNPPHWFGY
760 770 780 790
DSEGNPLDKI HSRVQLRTYS KLIVKEPFSI DEEDPDSKHQ
Note: No experimental confirmation available.
Length:790
Mass (Da):90,657
Last modified:March 15, 2005 - v2
Checksum:iE4E3C2BA2D680367
GO
Isoform 2 (identifier: Q8CDU4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     420-420: Q → QISVQGFRNIASSCTGIVHLTINDMPTLTDNCVK
     670-685: ITDAGMEILSARCHYL → VCMAAGALTGSRQGCT
     686-790: Missing.

Note: No experimental confirmation available.
Show »
Length:718
Mass (Da):81,888
Checksum:i37DE892DC15CC165
GO

Sequence cautioni

The sequence BAC26515 differs from that shown. Reason: Frameshift at position 7.Curated
The sequence BAC26821 differs from that shown. Reason: Frameshift at position 554.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti173L → W in BAC26821 (PubMed:16141072).Curated1
Sequence conflicti377R → K in BAC26515 (PubMed:16141072).Curated1
Sequence conflicti391R → E in BAC26515 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_013006420Q → QISVQGFRNIASSCTGIVHL TINDMPTLTDNCVK in isoform 2. 1 Publication1
Alternative sequenceiVSP_013007670 – 685ITDAG…RCHYL → VCMAAGALTGSRQGCT in isoform 2. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_013008686 – 790Missing in isoform 2. 1 PublicationAdd BLAST105

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK029566 mRNA. Translation: BAC26515.1. Frameshift.
AK030172 mRNA. Translation: BAC26821.1. Frameshift.
CCDSiCCDS51429.1. [Q8CDU4-1]
RefSeqiNP_796050.2. NM_177076.4. [Q8CDU4-1]
UniGeneiMm.442295.

Genome annotation databases

EnsembliENSMUST00000051358; ENSMUSP00000052716; ENSMUSG00000048520. [Q8CDU4-1]
GeneIDi320118.
KEGGimmu:320118.
UCSCiuc008wop.2. mouse. [Q8CDU4-1]
uc008woq.1. mouse. [Q8CDU4-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK029566 mRNA. Translation: BAC26515.1. Frameshift.
AK030172 mRNA. Translation: BAC26821.1. Frameshift.
CCDSiCCDS51429.1. [Q8CDU4-1]
RefSeqiNP_796050.2. NM_177076.4. [Q8CDU4-1]
UniGeneiMm.442295.

3D structure databases

ProteinModelPortaliQ8CDU4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi235772. 1 interactor.
STRINGi10090.ENSMUSP00000052716.

PTM databases

PhosphoSitePlusiQ8CDU4.

Proteomic databases

PaxDbiQ8CDU4.
PRIDEiQ8CDU4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000051358; ENSMUSP00000052716; ENSMUSG00000048520. [Q8CDU4-1]
GeneIDi320118.
KEGGimmu:320118.
UCSCiuc008wop.2. mouse. [Q8CDU4-1]
uc008woq.1. mouse. [Q8CDU4-2]

Organism-specific databases

CTDi222235.
MGIiMGI:2443416. Fbxl13.

Phylogenomic databases

eggNOGiENOG410IT20. Eukaryota.
ENOG410XPA4. LUCA.
GeneTreeiENSGT00760000119059.
HOGENOMiHOG000006699.
HOVERGENiHBG051673.
InParanoidiQ8CDU4.
KOiK10279.
OMAiPRWFGYD.
OrthoDBiEOG091G08EL.
PhylomeDBiQ8CDU4.
TreeFamiTF329711.

Enzyme and pathway databases

ReactomeiR-MMU-983168. Antigen processing: Ubiquitination & Proteasome degradation.

Miscellaneous databases

PROiQ8CDU4.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000048520.
CleanExiMM_FBXL13.
ExpressionAtlasiQ8CDU4. baseline and differential.

Family and domain databases

Gene3Di3.80.10.10. 2 hits.
InterProiIPR001810. F-box_dom.
IPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR006553. Leu-rich_rpt_Cys-con_subtyp.
[Graphical view]
PfamiPF12937. F-box-like. 1 hit.
PF13516. LRR_6. 3 hits.
[Graphical view]
SMARTiSM00256. FBOX. 1 hit.
SM00367. LRR_CC. 14 hits.
[Graphical view]
SUPFAMiSSF81383. SSF81383. 1 hit.
PROSITEiPS50181. FBOX. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiFXL13_MOUSE
AccessioniPrimary (citable) accession number: Q8CDU4
Secondary accession number(s): Q8CDE9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 15, 2005
Last sequence update: March 15, 2005
Last modified: November 2, 2016
This is version 108 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.