Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytosolic carboxypeptidase 2

Gene

Agbl2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Metallocarboxypeptidase that mediates deglutamylation of target proteins. Catalyzes the deglutamylation of polyglutamate side chains generated by post-translational polyglutamylation in proteins such as tubulins. Also removes gene-encoded polyglutamates from the carboxy-terminus of target proteins such as MYLK. Does not show detyrosinase or deglycylase activities from the carboxy-terminus of tubulin.1 Publication

Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Enzyme regulationi

Inhibited by RARRES1.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi425 – 4251ZincBy similarity
Metal bindingi428 – 4281ZincBy similarity
Active sitei475 – 4751NucleophileBy similarity
Metal bindingi521 – 5211ZincBy similarity

GO - Molecular functioni

  • metallocarboxypeptidase activity Source: UniProtKB
  • zinc ion binding Source: InterPro

GO - Biological processi

  • protein side chain deglutamylation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Carboxypeptidase, Hydrolase, Metalloprotease, Protease

Keywords - Ligandi

Metal-binding, Zinc

Protein family/group databases

MEROPSiM14.029.

Names & Taxonomyi

Protein namesi
Recommended name:
Cytosolic carboxypeptidase 2 (EC:3.4.17.-)
Alternative name(s):
ATP/GTP-binding protein-like 2
Gene namesi
Name:Agbl2
Synonyms:Ccp2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:2443254. Agbl2.

Subcellular locationi

GO - Cellular componenti

  • centriole Source: UniProtKB
  • ciliary basal body Source: UniProtKB
  • cytosol Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton

Pathology & Biotechi

Disruption phenotypei

AGBL2 and AGBL3 double mutants are viable and display no obvious phenotypic alterations.1 Publication

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi593 – 5931E → A: Abolishes deglutamylase activity. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 862862Cytosolic carboxypeptidase 2PRO_0000283750Add
BLAST

Proteomic databases

MaxQBiQ8CDK2.
PaxDbiQ8CDK2.
PRIDEiQ8CDK2.

PTM databases

iPTMnetiQ8CDK2.
PhosphoSiteiQ8CDK2.

Expressioni

Tissue specificityi

Widely expressed. Expressed in tissues with motile cilia such as testis, lung and trachea. Also detected in brain, eye, muscle, pancreas, intestine, stomach, pituitary, spleen, adrenal and kidney. Expressed in mitral and granular cells in brain.2 Publications

Inductioni

Up-regulated during ciliogenesis.1 Publication

Gene expression databases

BgeeiENSMUSG00000040812.
CleanExiMM_AGBL2.
ExpressionAtlasiQ8CDK2. baseline and differential.

Interactioni

Protein-protein interaction databases

IntActiQ8CDK2. 1 interaction.
MINTiMINT-4115341.
STRINGi10090.ENSMUSP00000048647.

Structurei

3D structure databases

ProteinModelPortaliQ8CDK2.
SMRiQ8CDK2. Positions 228-533.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the peptidase M14 family.Curated

Phylogenomic databases

eggNOGiKOG3641. Eukaryota.
COG2866. LUCA.
GeneTreeiENSGT00550000074405.
HOVERGENiHBG070840.
InParanoidiQ8CDK2.
OMAiIQFPHDQ.
OrthoDBiEOG091G0LY8.
PhylomeDBiQ8CDK2.
TreeFamiTF313794.

Family and domain databases

InterProiIPR000834. Peptidase_M14.
[Graphical view]
PfamiPF00246. Peptidase_M14. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8CDK2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNVLLEMAFL SQTLPDPYED FIHHHLQYYG YFKAQKSSLP NSGTHQRVWR
60 70 80 90 100
NSPRYMLNGS FGERDDFISD SLEKEMLLWP TCLSSTGHAH IDAVNRDSLL
110 120 130 140 150
LSSPLLRTRQ LIFDELDEAS PRLREPRELF SCFSSRGPLQ APRWPIECEV
160 170 180 190 200
IKENIHHIEW VPHQPEYFYQ PTGSEKVPEI VGEEQGTVVY QLDSVPAEGT
210 220 230 240 250
YFTSSRIGGK RGTIKELAVT LQGPDDNTLL FESRFESGNL QKAVRVGIYE
260 270 280 290 300
YELTLRTDLY TDKHTQWFYF RVQNTRKDAT YRFTIVNLLK PKSLYAVGMK
310 320 330 340 350
PLMYSQLDAT IYNIGWRREG REIKYYKNNV DDGQQPLYCL TWTTQFPHDQ
360 370 380 390 400
DTCFFAHFYP YTYTDLQCYL LSVANNPIQS QFCKLRALCR SLAGNTVYLL
410 420 430 440 450
TITNPSRTPQ EAAAKKAVVL SARVHPGESN SSWIMNGFLD FILSNSPDAQ
460 470 480 490 500
LLRDIFVFKV IPMLNPDGVI VGNYRCSLAG RDLNRHYKTV LKDSFPCIWY
510 520 530 540 550
TKNMIKRLLE EREVLLYCDF HGHSRKNNIF LYGCHSNNRK HWLHERVFPL
560 570 580 590 600
MLSKNAPDKF SFDSCNFKVQ KCKEGTGRVV MWRMGIINSY TMESTFGGST
610 620 630 640 650
LGSKRDTHFT IEDLKSLGYH VCDTLLDFCD PDQTKYTQCL QELKELLQQE
660 670 680 690 700
INKKLNNFGQ DMDLEGNWSD IPLSDIESST SGSDSSLSDG PPIRLLNIVA
710 720 730 740 750
DEPNQKTVLK NPKKKRLQTR KQRNEQYQKS YLMRELKLTE NAPGRARFVS
760 770 780 790 800
TLQKQPTFLK SPESPSPSVR RSENPRLNET QLSGREKGTS LDPPLTSPKN
810 820 830 840 850
KERIQSKKPG FTASCSPKRS TNSSLGPAPD VKPNWSKTRY SATRKDHATM
860
AVYPSLHIYT YP
Length:862
Mass (Da):99,216
Last modified:March 1, 2003 - v1
Checksum:iB532FEB80F6A8D04
GO
Isoform 2 (identifier: Q8CDK2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     806-809: SKKP → GFST
     810-862: Missing.

Show »
Length:809
Mass (Da):93,340
Checksum:iBAE5C35E86AE2D94
GO
Isoform 3 (identifier: Q8CDK2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     807-836: KKPGFTASCSPKRSTNSSLGPAPDVKPNWS → YSQPCVFSLILHEHQAQTSSDTPCQNPESH
     837-862: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:836
Mass (Da):96,401
Checksum:iDE456D5716FB146E
GO
Isoform 4 (identifier: Q8CDK2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     744-779: Missing.

Show »
Length:826
Mass (Da):95,136
Checksum:i0022036D11432658
GO
Isoform 5 (identifier: Q8CDK2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     79-97: WPTCLSSTGHAHIDAVNRD → Y
     744-779: Missing.

Show »
Length:808
Mass (Da):93,237
Checksum:iF036094EF78C2951
GO
Isoform 6 (identifier: Q8CDK2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-12: NVLLEMAFLSQ → FPALETELKPE
     806-809: SKKP → GFST
     810-862: Missing.

Note: No experimental confirmation available.
Show »
Length:809
Mass (Da):93,349
Checksum:iAAAEE32F6C6C44B4
GO
Isoform 7 (identifier: Q8CDK2-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-298: Missing.
     807-836: KKPGFTASCSPKRSTNSSLGPAPDVKPNWS → YSQPCVFSLILHEHQAQTSSDTPCQNPESH
     837-862: Missing.

Note: No experimental confirmation available.
Show »
Length:538
Mass (Da):61,885
Checksum:iB2B37B861A63FCF7
GO

Sequence cautioni

The sequence ABI51945 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence ABI51946 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence ABI51947 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence ABI51948 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence ABI51949 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAC37726 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAM20823 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti134 – 1341S → F in BAC26827 (PubMed:16141072).Curated
Sequence conflicti146 – 1461I → L in BAC26827 (PubMed:16141072).Curated
Sequence conflicti206 – 2061R → T in BAC26827 (PubMed:16141072).Curated
Sequence conflicti749 – 7491V → F in BAC26827 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 298298Missing in isoform 7. 1 PublicationVSP_024362Add
BLAST
Alternative sequencei2 – 1211NVLLEMAFLSQ → FPALETELKPE in isoform 6. 1 PublicationVSP_024363Add
BLAST
Alternative sequencei79 – 9719WPTCL…AVNRD → Y in isoform 5. 1 PublicationVSP_024364Add
BLAST
Alternative sequencei744 – 77936Missing in isoform 4 and isoform 5. 1 PublicationVSP_024365Add
BLAST
Alternative sequencei806 – 8094SKKP → GFST in isoform 2 and isoform 6. 2 PublicationsVSP_024366
Alternative sequencei807 – 83630KKPGF…KPNWS → YSQPCVFSLILHEHQAQTSS DTPCQNPESH in isoform 3 and isoform 7. 2 PublicationsVSP_024367Add
BLAST
Alternative sequencei810 – 86253Missing in isoform 2 and isoform 6. 2 PublicationsVSP_024368Add
BLAST
Alternative sequencei837 – 86226Missing in isoform 3 and isoform 7. 2 PublicationsVSP_024369Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ867026 mRNA. Translation: ABI51945.1. Different initiation.
DQ867027 mRNA. Translation: ABI51946.1. Different initiation.
DQ867028 mRNA. Translation: ABI51947.1. Different initiation.
DQ867029 mRNA. Translation: ABI51948.1. Different initiation.
DQ867030 mRNA. Translation: ABI51949.1. Different initiation.
AK029744 mRNA. Translation: BAC26594.1.
AK029932 mRNA. Translation: BAC26686.1.
AK030138 mRNA. Translation: BAC26802.1.
AK030182 mRNA. Translation: BAC26827.1.
AK040259 mRNA. Translation: BAC30555.2.
AK079691 mRNA. Translation: BAC37726.2. Different initiation.
AL714026 Genomic DNA. Translation: CAM20823.1. Sequence problems.
AL714026 Genomic DNA. Translation: CAM20824.1.
AL714026 Genomic DNA. Translation: CAM20825.1.
CCDSiCCDS38177.2. [Q8CDK2-1]
RefSeqiNP_848870.2. NM_178755.3. [Q8CDK2-1]
XP_006499695.1. XM_006499632.2. [Q8CDK2-1]
XP_006499703.1. XM_006499640.1. [Q8CDK2-4]
XP_006499704.1. XM_006499641.2. [Q8CDK2-6]
XP_006499705.1. XM_006499642.2. [Q8CDK2-2]
XP_006499706.1. XM_006499643.1. [Q8CDK2-5]
XP_011237881.1. XM_011239579.1. [Q8CDK2-5]
UniGeneiMm.61146.

Genome annotation databases

EnsembliENSMUST00000037206; ENSMUSP00000047936; ENSMUSG00000040812. [Q8CDK2-6]
ENSMUST00000037219; ENSMUSP00000048647; ENSMUSG00000040812. [Q8CDK2-1]
ENSMUST00000051831; ENSMUSP00000051620; ENSMUSG00000040812. [Q8CDK2-3]
ENSMUST00000111481; ENSMUSP00000107106; ENSMUSG00000040812. [Q8CDK2-1]
ENSMUST00000170320; ENSMUSP00000129216; ENSMUSG00000040812. [Q8CDK2-1]
GeneIDi271813.
KEGGimmu:271813.
UCSCiuc008ktc.2. mouse. [Q8CDK2-6]
uc008ktd.2. mouse. [Q8CDK2-2]
uc008kte.2. mouse. [Q8CDK2-1]
uc008ktg.2. mouse. [Q8CDK2-4]
uc008kth.2. mouse. [Q8CDK2-5]
uc008ktk.1. mouse. [Q8CDK2-7]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ867026 mRNA. Translation: ABI51945.1. Different initiation.
DQ867027 mRNA. Translation: ABI51946.1. Different initiation.
DQ867028 mRNA. Translation: ABI51947.1. Different initiation.
DQ867029 mRNA. Translation: ABI51948.1. Different initiation.
DQ867030 mRNA. Translation: ABI51949.1. Different initiation.
AK029744 mRNA. Translation: BAC26594.1.
AK029932 mRNA. Translation: BAC26686.1.
AK030138 mRNA. Translation: BAC26802.1.
AK030182 mRNA. Translation: BAC26827.1.
AK040259 mRNA. Translation: BAC30555.2.
AK079691 mRNA. Translation: BAC37726.2. Different initiation.
AL714026 Genomic DNA. Translation: CAM20823.1. Sequence problems.
AL714026 Genomic DNA. Translation: CAM20824.1.
AL714026 Genomic DNA. Translation: CAM20825.1.
CCDSiCCDS38177.2. [Q8CDK2-1]
RefSeqiNP_848870.2. NM_178755.3. [Q8CDK2-1]
XP_006499695.1. XM_006499632.2. [Q8CDK2-1]
XP_006499703.1. XM_006499640.1. [Q8CDK2-4]
XP_006499704.1. XM_006499641.2. [Q8CDK2-6]
XP_006499705.1. XM_006499642.2. [Q8CDK2-2]
XP_006499706.1. XM_006499643.1. [Q8CDK2-5]
XP_011237881.1. XM_011239579.1. [Q8CDK2-5]
UniGeneiMm.61146.

3D structure databases

ProteinModelPortaliQ8CDK2.
SMRiQ8CDK2. Positions 228-533.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ8CDK2. 1 interaction.
MINTiMINT-4115341.
STRINGi10090.ENSMUSP00000048647.

Protein family/group databases

MEROPSiM14.029.

PTM databases

iPTMnetiQ8CDK2.
PhosphoSiteiQ8CDK2.

Proteomic databases

MaxQBiQ8CDK2.
PaxDbiQ8CDK2.
PRIDEiQ8CDK2.

Protocols and materials databases

DNASUi271813.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000037206; ENSMUSP00000047936; ENSMUSG00000040812. [Q8CDK2-6]
ENSMUST00000037219; ENSMUSP00000048647; ENSMUSG00000040812. [Q8CDK2-1]
ENSMUST00000051831; ENSMUSP00000051620; ENSMUSG00000040812. [Q8CDK2-3]
ENSMUST00000111481; ENSMUSP00000107106; ENSMUSG00000040812. [Q8CDK2-1]
ENSMUST00000170320; ENSMUSP00000129216; ENSMUSG00000040812. [Q8CDK2-1]
GeneIDi271813.
KEGGimmu:271813.
UCSCiuc008ktc.2. mouse. [Q8CDK2-6]
uc008ktd.2. mouse. [Q8CDK2-2]
uc008kte.2. mouse. [Q8CDK2-1]
uc008ktg.2. mouse. [Q8CDK2-4]
uc008kth.2. mouse. [Q8CDK2-5]
uc008ktk.1. mouse. [Q8CDK2-7]

Organism-specific databases

CTDi79841.
MGIiMGI:2443254. Agbl2.

Phylogenomic databases

eggNOGiKOG3641. Eukaryota.
COG2866. LUCA.
GeneTreeiENSGT00550000074405.
HOVERGENiHBG070840.
InParanoidiQ8CDK2.
OMAiIQFPHDQ.
OrthoDBiEOG091G0LY8.
PhylomeDBiQ8CDK2.
TreeFamiTF313794.

Miscellaneous databases

PROiQ8CDK2.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000040812.
CleanExiMM_AGBL2.
ExpressionAtlasiQ8CDK2. baseline and differential.

Family and domain databases

InterProiIPR000834. Peptidase_M14.
[Graphical view]
PfamiPF00246. Peptidase_M14. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCBPC2_MOUSE
AccessioniPrimary (citable) accession number: Q8CDK2
Secondary accession number(s): A2AH35
, Q09M08, Q09M09, Q09M10, Q09M11, Q09M12, Q8C529, Q8C9X4, Q8CDE6, Q8CDF6, Q8CDQ1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: March 1, 2003
Last modified: September 7, 2016
This is version 108 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Caution

Was originally thought to have detyrosinating activity from C-terminal positions on tubulin.By similarity

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.