Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8CCN5 (BCAS3_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 96. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Breast carcinoma-amplified sequence 3 homolog
Alternative name(s):
K20D4
Gene names
Name:Bcas3
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length928 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Subcellular location

Nucleus Potential.

Sequence similarities

Belongs to the WD repeat BCAS3 family.

Contains 3 WD repeats.

Sequence caution

The sequence AAG34697.1 differs from that shown. Reason: Erroneous termination at position 388. Translated as Ser.

Ontologies

Keywords
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
   DomainRepeat
WD repeat
   PTMAcetylation
Phosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentcell periphery

Inferred from direct assay PubMed 16099728. Source: MGI

cytoplasm

Inferred from direct assay PubMed 16099728. Source: MGI

nucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8CCN5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8CCN5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     498-527: LTSQDSYNNFTNNNPGNPRLSPLPSLMVVT → HFPLMLLSSRFLLYHLGSDANFYSVCAEHS
     528-928: Missing.
Note: Due to an intron retention.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 928928Breast carcinoma-amplified sequence 3 homolog
PRO_0000050884

Regions

Repeat74 – 11441WD 1
Repeat349 – 38941WD 2
Repeat403 – 44745WD 3

Amino acid modifications

Modified residue11N-acetylmethionine By similarity
Modified residue4801Phosphoserine Ref.3
Modified residue8861Phosphoserine By similarity

Natural variations

Alternative sequence498 – 52730LTSQD…LMVVT → HFPLMLLSSRFLLYHLGSDA NFYSVCAEHS in isoform 2.
VSP_007861
Alternative sequence528 – 928401Missing in isoform 2.
VSP_007862

Experimental info

Sequence conflict751R → Q in BAC27862. Ref.1
Sequence conflict4721T → D Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 25, 2003. Version 2.
Checksum: EF8FE46CF7011A7B

FASTA928101,021
        10         20         30         40         50         60 
MNETMATDSP RRPSRCTGGV VVRPQAVTEQ SYMESVVTFL QDVVPQAYSG SPLTEEKEKI 

        70         80         90        100        110        120 
VWVRFENADL NDTSRNLEFH ELHSTGNEPP LLVMIGYSDG MQVWGIPISG EAQELFSVRH 

       130        140        150        160        170        180 
GPVRAARILP APQLGAQKCD NFAEKRPLLG VCKSIGSSGT TPPYCCVDLY SLRTGEMVKS 

       190        200        210        220        230        240 
IQFKTPIYDL HCNKRILVVV LQEKIAAFDS CTFTKKFFVT SCYPCPGPNM NPIALGSRWL 

       250        260        270        280        290        300 
AYAENKLIRC HQSRGGACGD NIQSYTATVL SAAKTLKSGL TMVGKVVTQL TGTLPSGVTE 

       310        320        330        340        350        360 
DDVALHCNSR RSPLVPGIIT VIDTETVGEG QVLVSEDSDS DGIVAHFPAH EKPVCCMAFN 

       370        380        390        400        410        420 
TSGMLLVTTD TLGHDFHVFQ ILTHPWSSSQ CAVHHLYTLH RGETEAKVQD ICFSHDCRWV 

       430        440        450        460        470        480 
VVSTLRGTSH VFPINPYGGQ PCVRTHMSPR VVNRMSRFQK SAGLEEIEQE LTSKQGGRCS 

       490        500        510        520        530        540 
PVPGLSSSPS GSPLHGKLTS QDSYNNFTNN NPGNPRLSPL PSLMVVTPLA QIKQPMTLGT 

       550        560        570        580        590        600 
ITKRTGPYLF GAGCFSIKAP CKVKSPPQIS PSKSMGGEFC VAAVFGTSRS WFANNAGLKR 

       610        620        630        640        650        660 
EKDQSKQVVV ESLYIISCYG TLVEHMIEPR PISTAPKISD DTPLEIMTSP RASWTLVRTP 

       670        680        690        700        710        720 
QWNELQPPFN ANHPLLLAAE AVQYYQLLLA GSLPPGSPGP ITRHGSYDSL ASDHSGQEDE 

       730        740        750        760        770        780 
EWLSQVEIVT HTGPHRRLWM GPQFHFKTIQ TSGQTTVIST SSSVLQSHGP SDTPQPLLDF 

       790        800        810        820        830        840 
DTDDLDLNSL RIQPVRSDPV SMPGSSRAVS DRRGVSTVTD AASGTFDRSV TLLEVCGSWP 

       850        860        870        880        890        900 
EGFGLRHMSS MEHSEEGLRE RLADAMAESP SRDVVGSGTE LQREGSIETL SNSSGSTSGS 

       910        920 
IPRNFDGYRS PLPTNESQPL SLFPTGFP 

« Hide

Isoform 2 [UniParc].

Checksum: F4F4A2004EF5975D
Show »

FASTA52757,719

References

« Hide 'large scale' references
[1]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Strain: C57BL/6J.
Tissue: Diencephalon and Olfactory bulb.
[2]"A gene trap clone K20D4 is expressed during vascular development."
Inamdar M.S.
Submitted (OCT-2000) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-477 (ISOFORM 1).
[3]"Large-scale phosphorylation analysis of mouse liver."
Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-480, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Liver.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK032423 mRNA. Translation: BAC27862.1.
AK034117 mRNA. Translation: BAC28592.1.
AF313800 mRNA. Translation: AAG34697.1. Sequence problems.
CCDSCCDS25195.1. [Q8CCN5-1]
RefSeqNP_001160114.1. NM_001166642.1.
NP_619622.3. NM_138681.4. [Q8CCN5-1]
XP_006532603.1. XM_006532540.1. [Q8CCN5-1]
UniGeneMm.287663.

3D structure databases

ProteinModelPortalQ8CCN5.
SMRQ8CCN5. Positions 167-192, 345-373.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteQ8CCN5.

Proteomic databases

MaxQBQ8CCN5.
PaxDbQ8CCN5.
PRIDEQ8CCN5.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000074875; ENSMUSP00000074416; ENSMUSG00000059439. [Q8CCN5-1]
ENSMUST00000108056; ENSMUSP00000103691; ENSMUSG00000059439. [Q8CCN5-2]
GeneID192197.
KEGGmmu:192197.
UCSCuc007krp.2. mouse. [Q8CCN5-1]

Organism-specific databases

CTD54828.
MGIMGI:2385848. Bcas3.

Phylogenomic databases

eggNOGNOG321894.
GeneTreeENSGT00390000006454.
HOGENOMHOG000049129.
HOVERGENHBG050676.
OrthoDBEOG75MVVN.

Gene expression databases

ArrayExpressQ8CCN5.
BgeeQ8CCN5.
CleanExMM_BCAS3.
GenevestigatorQ8CCN5.

Family and domain databases

Gene3D2.130.10.10. 2 hits.
InterProIPR022175. BCAS3.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamPF12490. BCAS3. 1 hit.
[Graphical view]
SMARTSM00320. WD40. 2 hits.
[Graphical view]
SUPFAMSSF50978. SSF50978. 2 hits.
ProtoNetSearch...

Other

NextBio371234.
PROQ8CCN5.
SOURCESearch...

Entry information

Entry nameBCAS3_MOUSE
AccessionPrimary (citable) accession number: Q8CCN5
Secondary accession number(s): Q8CC16, Q9EPX3
Entry history
Integrated into UniProtKB/Swiss-Prot: July 25, 2003
Last sequence update: July 25, 2003
Last modified: July 9, 2014
This is version 96 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot