Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8CCN5

- BCAS3_MOUSE

UniProt

Q8CCN5 - BCAS3_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Breast carcinoma-amplified sequence 3 homolog

Gene

Bcas3

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Functions synergistically with PELP1 as a transcriptional coactivator of estrogen receptor-responsive genes. Stimulates histone acetyltransferase activity. Binds to chromatin (By similarity). Plays a role in angiogenesis. Participates in the regulation of cell polarity and directional endothelial cell migration by mediating both the activation and recruitment of CDC42 and the reorganization of the actin cytoskeleton at the cell leading edge. Promotes filipodia formation.By similarity1 Publication

GO - Molecular functioni

  1. beta-tubulin binding Source: UniProtKB
  2. chromatin binding Source: UniProtKB

GO - Biological processi

  1. activation of Cdc42 GTPase activity Source: UniProtKB
  2. cellular response to estrogen stimulus Source: UniProtKB
  3. Golgi organization Source: UniProtKB
  4. microtubule organizing center organization Source: UniProtKB
  5. negative regulation of focal adhesion assembly Source: UniProtKB
  6. negative regulation of Rho GTPase activity Source: UniProtKB
  7. positive regulation of actin cytoskeleton reorganization Source: UniProtKB
  8. positive regulation of catalytic activity Source: UniProtKB
  9. positive regulation of Cdc42 GTPase activity Source: UniProtKB
  10. positive regulation of endothelial cell migration Source: UniProtKB
  11. positive regulation of filopodium assembly Source: UniProtKB
  12. positive regulation of intracellular protein transport Source: UniProtKB
  13. positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  14. regulation of establishment of cell polarity Source: UniProtKB
  15. tube formation Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Angiogenesis, Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Breast carcinoma-amplified sequence 3 homologBy similarity
Alternative name(s):
K20D41 Publication
Protein rudhira1 Publication
Gene namesi
Name:Bcas3ImportedBy similarity
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 11

Organism-specific databases

MGIiMGI:2385848. Bcas3.

Subcellular locationi

Nucleus By similarity. Cytoplasm 2 Publications. Cytoplasmcytoskeleton 1 Publication
Note: Associates with chromatin. Recruited to estrogen receptor-induced promoters in a PELP1-dependent manner (By similarity). Localizes in the cytoplasm in stationary cells. Translocates from the cytoplasm to the leading edge in motile cells. Colocalizes with microtubules and intermediate filaments in both stationary and motile cells.By similarity1 Publication

GO - Cellular componenti

  1. cell leading edge Source: UniProtKB
  2. cell periphery Source: MGI
  3. cytoplasm Source: UniProtKB
  4. cytoplasmic microtubule Source: UniProtKB
  5. intermediate filament cytoskeleton Source: UniProtKB
  6. nucleus Source: UniProtKB
  7. transcriptionally active chromatin Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 928928Breast carcinoma-amplified sequence 3 homologPRO_0000050884Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineBy similarity
Modified residuei480 – 4801Phosphoserine1 Publication
Modified residuei886 – 8861PhosphoserineBy similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ8CCN5.
PaxDbiQ8CCN5.
PRIDEiQ8CCN5.

PTM databases

PhosphoSiteiQ8CCN5.

Expressioni

Tissue specificityi

Expressed in blood islands and yolk sac blood islands (at protein level). Highly expressed in mammary tumors. Expressed in eostrogen-induced epithelial cells of mammary glands. Expressed in brain, heart, kidney, lung, liver and spleen. Expressed in embryonic stem cells, embryoid bodies, endothelial cells and fibroblasts.3 Publications

Developmental stagei

Expressed in erythroid cells in the vessels at 9.5 and 10.5 dpc (at protein level). Expressed in embryo at 7.5 dpc and in the yolk sac at 10.5 dpc. Expressed in the heart and yolk sac mesoderm at 8.5 dpc. Expressed in the head mesenchyme, somitic mesoderm, otic vesicle, vessels and few blood cells at 9.5 to 11.5 dpc.1 Publication

Inductioni

Up-regulated by PELP1 in response to estrogen.1 Publication

Gene expression databases

BgeeiQ8CCN5.
CleanExiMM_BCAS3.
ExpressionAtlasiQ8CCN5. baseline and differential.
GenevestigatoriQ8CCN5.

Interactioni

Subunit structurei

Interacts with histone H3, ESR1, KAT2B and PELP1; the interactions occur in a estrogen-dependent manner. Interacts with beta-tubulin and VIM.By similarity

Structurei

3D structure databases

ProteinModelPortaliQ8CCN5.
SMRiQ8CCN5. Positions 166-220, 347-381, 399-435.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati74 – 11441WD 1Add
BLAST
Repeati349 – 38941WD 2Add
BLAST
Repeati403 – 44745WD 3Add
BLAST

Sequence similaritiesi

Belongs to the WD repeat BCAS3 family.Curated
Contains 3 WD repeats.Curated

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiNOG321894.
GeneTreeiENSGT00390000006454.
HOGENOMiHOG000049129.
HOVERGENiHBG050676.
InParanoidiQ8CCN5.
OrthoDBiEOG75MVVN.

Family and domain databases

Gene3Di2.130.10.10. 2 hits.
InterProiIPR022175. BCAS3.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF12490. BCAS3. 1 hit.
[Graphical view]
SMARTiSM00320. WD40. 2 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 2 hits.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8CCN5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNETMATDSP RRPSRCTGGV VVRPQAVTEQ SYMESVVTFL QDVVPQAYSG
60 70 80 90 100
SPLTEEKEKI VWVRFENADL NDTSRNLEFH ELHSTGNEPP LLVMIGYSDG
110 120 130 140 150
MQVWGIPISG EAQELFSVRH GPVRAARILP APQLGAQKCD NFAEKRPLLG
160 170 180 190 200
VCKSIGSSGT TPPYCCVDLY SLRTGEMVKS IQFKTPIYDL HCNKRILVVV
210 220 230 240 250
LQEKIAAFDS CTFTKKFFVT SCYPCPGPNM NPIALGSRWL AYAENKLIRC
260 270 280 290 300
HQSRGGACGD NIQSYTATVL SAAKTLKSGL TMVGKVVTQL TGTLPSGVTE
310 320 330 340 350
DDVALHCNSR RSPLVPGIIT VIDTETVGEG QVLVSEDSDS DGIVAHFPAH
360 370 380 390 400
EKPVCCMAFN TSGMLLVTTD TLGHDFHVFQ ILTHPWSSSQ CAVHHLYTLH
410 420 430 440 450
RGETEAKVQD ICFSHDCRWV VVSTLRGTSH VFPINPYGGQ PCVRTHMSPR
460 470 480 490 500
VVNRMSRFQK SAGLEEIEQE LTSKQGGRCS PVPGLSSSPS GSPLHGKLTS
510 520 530 540 550
QDSYNNFTNN NPGNPRLSPL PSLMVVTPLA QIKQPMTLGT ITKRTGPYLF
560 570 580 590 600
GAGCFSIKAP CKVKSPPQIS PSKSMGGEFC VAAVFGTSRS WFANNAGLKR
610 620 630 640 650
EKDQSKQVVV ESLYIISCYG TLVEHMIEPR PISTAPKISD DTPLEIMTSP
660 670 680 690 700
RASWTLVRTP QWNELQPPFN ANHPLLLAAE AVQYYQLLLA GSLPPGSPGP
710 720 730 740 750
ITRHGSYDSL ASDHSGQEDE EWLSQVEIVT HTGPHRRLWM GPQFHFKTIQ
760 770 780 790 800
TSGQTTVIST SSSVLQSHGP SDTPQPLLDF DTDDLDLNSL RIQPVRSDPV
810 820 830 840 850
SMPGSSRAVS DRRGVSTVTD AASGTFDRSV TLLEVCGSWP EGFGLRHMSS
860 870 880 890 900
MEHSEEGLRE RLADAMAESP SRDVVGSGTE LQREGSIETL SNSSGSTSGS
910 920
IPRNFDGYRS PLPTNESQPL SLFPTGFP
Length:928
Mass (Da):101,021
Last modified:July 25, 2003 - v2
Checksum:iEF8FE46CF7011A7B
GO
Isoform 2 (identifier: Q8CCN5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     498-527: LTSQDSYNNFTNNNPGNPRLSPLPSLMVVT → HFPLMLLSSRFLLYHLGSDANFYSVCAEHS
     528-928: Missing.

Note: Due to an intron retention.

Show »
Length:527
Mass (Da):57,719
Checksum:iF4F4A2004EF5975D
GO

Sequence cautioni

The sequence AAG34697.1 differs from that shown. Reason: Erroneous termination at position 388. Translated as Ser.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti75 – 751R → Q in BAC27862. (PubMed:16141072)Curated
Sequence conflicti472 – 4721T → D(PubMed:16099728)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei498 – 52730LTSQD…LMVVT → HFPLMLLSSRFLLYHLGSDA NFYSVCAEHS in isoform 2. 1 PublicationVSP_007861Add
BLAST
Alternative sequencei528 – 928401Missing in isoform 2. 1 PublicationVSP_007862Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF313800 mRNA. Translation: AAG34697.1. Sequence problems.
AK032423 mRNA. Translation: BAC27862.1.
AK034117 mRNA. Translation: BAC28592.1.
CCDSiCCDS25195.1. [Q8CCN5-1]
RefSeqiNP_001160114.1. NM_001166642.1.
NP_619622.3. NM_138681.4. [Q8CCN5-1]
XP_006532603.1. XM_006532540.1. [Q8CCN5-1]
UniGeneiMm.287663.

Genome annotation databases

EnsembliENSMUST00000074875; ENSMUSP00000074416; ENSMUSG00000059439. [Q8CCN5-1]
ENSMUST00000108056; ENSMUSP00000103691; ENSMUSG00000059439. [Q8CCN5-2]
GeneIDi192197.
KEGGimmu:192197.
UCSCiuc007krp.2. mouse. [Q8CCN5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF313800 mRNA. Translation: AAG34697.1 . Sequence problems.
AK032423 mRNA. Translation: BAC27862.1 .
AK034117 mRNA. Translation: BAC28592.1 .
CCDSi CCDS25195.1. [Q8CCN5-1 ]
RefSeqi NP_001160114.1. NM_001166642.1.
NP_619622.3. NM_138681.4. [Q8CCN5-1 ]
XP_006532603.1. XM_006532540.1. [Q8CCN5-1 ]
UniGenei Mm.287663.

3D structure databases

ProteinModelPortali Q8CCN5.
SMRi Q8CCN5. Positions 166-220, 347-381, 399-435.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q8CCN5.

Proteomic databases

MaxQBi Q8CCN5.
PaxDbi Q8CCN5.
PRIDEi Q8CCN5.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000074875 ; ENSMUSP00000074416 ; ENSMUSG00000059439 . [Q8CCN5-1 ]
ENSMUST00000108056 ; ENSMUSP00000103691 ; ENSMUSG00000059439 . [Q8CCN5-2 ]
GeneIDi 192197.
KEGGi mmu:192197.
UCSCi uc007krp.2. mouse. [Q8CCN5-1 ]

Organism-specific databases

CTDi 54828.
MGIi MGI:2385848. Bcas3.

Phylogenomic databases

eggNOGi NOG321894.
GeneTreei ENSGT00390000006454.
HOGENOMi HOG000049129.
HOVERGENi HBG050676.
InParanoidi Q8CCN5.
OrthoDBi EOG75MVVN.

Miscellaneous databases

NextBioi 371234.
PROi Q8CCN5.
SOURCEi Search...

Gene expression databases

Bgeei Q8CCN5.
CleanExi MM_BCAS3.
ExpressionAtlasi Q8CCN5. baseline and differential.
Genevestigatori Q8CCN5.

Family and domain databases

Gene3Di 2.130.10.10. 2 hits.
InterProi IPR022175. BCAS3.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view ]
Pfami PF12490. BCAS3. 1 hit.
[Graphical view ]
SMARTi SM00320. WD40. 2 hits.
[Graphical view ]
SUPFAMi SSF50978. SSF50978. 2 hits.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: C57BL/6J.
    Tissue: Diencephalon and Olfactory bulb.
  2. "Rudhira is a cytoplasmic WD40 protein expressed in mouse embryonic stem cells and during embryonic erythropoiesis."
    Siva K., Inamdar M.S.
    Gene Expr. Patterns 6:225-234(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-477 (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
  3. Cited for: TISSUE SPECIFICITY.
  4. Erratum
    Gururaj A.E., Singh R.R., Rayala S.K., Holm C., den Hollander P., Zhang H., Balasenthil S., Talukder A.H., Landberg G., Kumar R.
    Proc. Natl. Acad. Sci. U.S.A. 110:4147-4148(2013)
  5. "Estrogen induces expression of BCAS3, a novel estrogen receptor-alpha coactivator, through proline-, glutamic acid-, and leucine-rich protein-1 (PELP1)."
    Gururaj A.E., Peng S., Vadlamudi R.K., Kumar R.
    Mol. Endocrinol. 21:1847-1860(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION, CHROMATIN-BINDING.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-480, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  7. "Rudhira/BCAS3 is a cytoskeletal protein that controls Cdc42 activation and directional cell migration during angiogenesis."
    Jain M., Bhat G.P., Vijayra havan K., Inamdar M.S.
    Exp. Cell Res. 318:753-767(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION.

Entry informationi

Entry nameiBCAS3_MOUSE
AccessioniPrimary (citable) accession number: Q8CCN5
Secondary accession number(s): Q8CC16, Q9EPX3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 25, 2003
Last sequence update: July 25, 2003
Last modified: October 29, 2014
This is version 98 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Miscellaneous

'Rudhira' stands for 'blood' in Sanskrit as this protein is strongly expressed in blood vessels.1 Publication

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3