SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8CCN5

- BCAS3_MOUSE

UniProt

Q8CCN5 - BCAS3_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Breast carcinoma-amplified sequence 3 homolog

Gene
Bcas3
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Breast carcinoma-amplified sequence 3 homolog
Alternative name(s):
K20D4
Gene namesi
Name:Bcas3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 11

Organism-specific databases

MGIiMGI:2385848. Bcas3.

Subcellular locationi

Nucleus Reviewed prediction

GO - Cellular componenti

  1. cell periphery Source: MGI
  2. cytoplasm Source: MGI
  3. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 928928Breast carcinoma-amplified sequence 3 homologPRO_0000050884Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionine By similarity
Modified residuei480 – 4801Phosphoserine1 Publication
Modified residuei886 – 8861Phosphoserine By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ8CCN5.
PaxDbiQ8CCN5.
PRIDEiQ8CCN5.

PTM databases

PhosphoSiteiQ8CCN5.

Expressioni

Gene expression databases

ArrayExpressiQ8CCN5.
BgeeiQ8CCN5.
CleanExiMM_BCAS3.
GenevestigatoriQ8CCN5.

Structurei

3D structure databases

ProteinModelPortaliQ8CCN5.
SMRiQ8CCN5. Positions 167-192, 345-373.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati74 – 11441WD 1Add
BLAST
Repeati349 – 38941WD 2Add
BLAST
Repeati403 – 44745WD 3Add
BLAST

Sequence similaritiesi

Belongs to the WD repeat BCAS3 family.
Contains 3 WD repeats.

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiNOG321894.
GeneTreeiENSGT00390000006454.
HOGENOMiHOG000049129.
HOVERGENiHBG050676.
OrthoDBiEOG75MVVN.

Family and domain databases

Gene3Di2.130.10.10. 2 hits.
InterProiIPR022175. BCAS3.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF12490. BCAS3. 1 hit.
[Graphical view]
SMARTiSM00320. WD40. 2 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 2 hits.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8CCN5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MNETMATDSP RRPSRCTGGV VVRPQAVTEQ SYMESVVTFL QDVVPQAYSG    50
SPLTEEKEKI VWVRFENADL NDTSRNLEFH ELHSTGNEPP LLVMIGYSDG 100
MQVWGIPISG EAQELFSVRH GPVRAARILP APQLGAQKCD NFAEKRPLLG 150
VCKSIGSSGT TPPYCCVDLY SLRTGEMVKS IQFKTPIYDL HCNKRILVVV 200
LQEKIAAFDS CTFTKKFFVT SCYPCPGPNM NPIALGSRWL AYAENKLIRC 250
HQSRGGACGD NIQSYTATVL SAAKTLKSGL TMVGKVVTQL TGTLPSGVTE 300
DDVALHCNSR RSPLVPGIIT VIDTETVGEG QVLVSEDSDS DGIVAHFPAH 350
EKPVCCMAFN TSGMLLVTTD TLGHDFHVFQ ILTHPWSSSQ CAVHHLYTLH 400
RGETEAKVQD ICFSHDCRWV VVSTLRGTSH VFPINPYGGQ PCVRTHMSPR 450
VVNRMSRFQK SAGLEEIEQE LTSKQGGRCS PVPGLSSSPS GSPLHGKLTS 500
QDSYNNFTNN NPGNPRLSPL PSLMVVTPLA QIKQPMTLGT ITKRTGPYLF 550
GAGCFSIKAP CKVKSPPQIS PSKSMGGEFC VAAVFGTSRS WFANNAGLKR 600
EKDQSKQVVV ESLYIISCYG TLVEHMIEPR PISTAPKISD DTPLEIMTSP 650
RASWTLVRTP QWNELQPPFN ANHPLLLAAE AVQYYQLLLA GSLPPGSPGP 700
ITRHGSYDSL ASDHSGQEDE EWLSQVEIVT HTGPHRRLWM GPQFHFKTIQ 750
TSGQTTVIST SSSVLQSHGP SDTPQPLLDF DTDDLDLNSL RIQPVRSDPV 800
SMPGSSRAVS DRRGVSTVTD AASGTFDRSV TLLEVCGSWP EGFGLRHMSS 850
MEHSEEGLRE RLADAMAESP SRDVVGSGTE LQREGSIETL SNSSGSTSGS 900
IPRNFDGYRS PLPTNESQPL SLFPTGFP 928
Length:928
Mass (Da):101,021
Last modified:July 25, 2003 - v2
Checksum:iEF8FE46CF7011A7B
GO
Isoform 2 (identifier: Q8CCN5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     498-527: LTSQDSYNNFTNNNPGNPRLSPLPSLMVVT → HFPLMLLSSRFLLYHLGSDANFYSVCAEHS
     528-928: Missing.

Note: Due to an intron retention.

Show »
Length:527
Mass (Da):57,719
Checksum:iF4F4A2004EF5975D
GO

Sequence cautioni

The sequence AAG34697.1 differs from that shown. Reason: Erroneous termination at position 388. Translated as Ser.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei498 – 52730LTSQD…LMVVT → HFPLMLLSSRFLLYHLGSDA NFYSVCAEHS in isoform 2. VSP_007861Add
BLAST
Alternative sequencei528 – 928401Missing in isoform 2. VSP_007862Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti75 – 751R → Q in BAC27862. 1 Publication
Sequence conflicti472 – 4721T → D1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK032423 mRNA. Translation: BAC27862.1.
AK034117 mRNA. Translation: BAC28592.1.
AF313800 mRNA. Translation: AAG34697.1. Sequence problems.
CCDSiCCDS25195.1. [Q8CCN5-1]
RefSeqiNP_001160114.1. NM_001166642.1.
NP_619622.3. NM_138681.4. [Q8CCN5-1]
XP_006532603.1. XM_006532540.1. [Q8CCN5-1]
UniGeneiMm.287663.

Genome annotation databases

EnsembliENSMUST00000074875; ENSMUSP00000074416; ENSMUSG00000059439. [Q8CCN5-1]
ENSMUST00000108056; ENSMUSP00000103691; ENSMUSG00000059439. [Q8CCN5-2]
GeneIDi192197.
KEGGimmu:192197.
UCSCiuc007krp.2. mouse. [Q8CCN5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK032423 mRNA. Translation: BAC27862.1 .
AK034117 mRNA. Translation: BAC28592.1 .
AF313800 mRNA. Translation: AAG34697.1 . Sequence problems.
CCDSi CCDS25195.1. [Q8CCN5-1 ]
RefSeqi NP_001160114.1. NM_001166642.1.
NP_619622.3. NM_138681.4. [Q8CCN5-1 ]
XP_006532603.1. XM_006532540.1. [Q8CCN5-1 ]
UniGenei Mm.287663.

3D structure databases

ProteinModelPortali Q8CCN5.
SMRi Q8CCN5. Positions 167-192, 345-373.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q8CCN5.

Proteomic databases

MaxQBi Q8CCN5.
PaxDbi Q8CCN5.
PRIDEi Q8CCN5.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000074875 ; ENSMUSP00000074416 ; ENSMUSG00000059439 . [Q8CCN5-1 ]
ENSMUST00000108056 ; ENSMUSP00000103691 ; ENSMUSG00000059439 . [Q8CCN5-2 ]
GeneIDi 192197.
KEGGi mmu:192197.
UCSCi uc007krp.2. mouse. [Q8CCN5-1 ]

Organism-specific databases

CTDi 54828.
MGIi MGI:2385848. Bcas3.

Phylogenomic databases

eggNOGi NOG321894.
GeneTreei ENSGT00390000006454.
HOGENOMi HOG000049129.
HOVERGENi HBG050676.
OrthoDBi EOG75MVVN.

Miscellaneous databases

NextBioi 371234.
PROi Q8CCN5.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q8CCN5.
Bgeei Q8CCN5.
CleanExi MM_BCAS3.
Genevestigatori Q8CCN5.

Family and domain databases

Gene3Di 2.130.10.10. 2 hits.
InterProi IPR022175. BCAS3.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view ]
Pfami PF12490. BCAS3. 1 hit.
[Graphical view ]
SMARTi SM00320. WD40. 2 hits.
[Graphical view ]
SUPFAMi SSF50978. SSF50978. 2 hits.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: C57BL/6J.
    Tissue: Diencephalon and Olfactory bulb.
  2. "A gene trap clone K20D4 is expressed during vascular development."
    Inamdar M.S.
    Submitted (OCT-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-477 (ISOFORM 1).
  3. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-480, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiBCAS3_MOUSE
AccessioniPrimary (citable) accession number: Q8CCN5
Secondary accession number(s): Q8CC16, Q9EPX3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 25, 2003
Last sequence update: July 25, 2003
Last modified: July 9, 2014
This is version 96 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi