Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8CCN5

- BCAS3_MOUSE

UniProt

Q8CCN5 - BCAS3_MOUSE

Protein

Breast carcinoma-amplified sequence 3 homolog

Gene

Bcas3

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 97 (01 Oct 2014)
      Sequence version 2 (25 Jul 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Breast carcinoma-amplified sequence 3 homolog
    Alternative name(s):
    K20D4
    Gene namesi
    Name:Bcas3
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 11

    Organism-specific databases

    MGIiMGI:2385848. Bcas3.

    Subcellular locationi

    Nucleus By similarity. Cytoplasm By similarity

    GO - Cellular componenti

    1. cell periphery Source: MGI
    2. cytoplasm Source: MGI
    3. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 928928Breast carcinoma-amplified sequence 3 homologPRO_0000050884Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionineBy similarity
    Modified residuei480 – 4801Phosphoserine1 Publication
    Modified residuei886 – 8861PhosphoserineBy similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ8CCN5.
    PaxDbiQ8CCN5.
    PRIDEiQ8CCN5.

    PTM databases

    PhosphoSiteiQ8CCN5.

    Expressioni

    Tissue specificityi

    Highly expressed in mammary tumors.1 Publication

    Gene expression databases

    ArrayExpressiQ8CCN5.
    BgeeiQ8CCN5.
    CleanExiMM_BCAS3.
    GenevestigatoriQ8CCN5.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8CCN5.
    SMRiQ8CCN5. Positions 167-192, 345-373.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati74 – 11441WD 1Add
    BLAST
    Repeati349 – 38941WD 2Add
    BLAST
    Repeati403 – 44745WD 3Add
    BLAST

    Sequence similaritiesi

    Belongs to the WD repeat BCAS3 family.Curated
    Contains 3 WD repeats.Curated

    Keywords - Domaini

    Repeat, WD repeat

    Phylogenomic databases

    eggNOGiNOG321894.
    GeneTreeiENSGT00390000006454.
    HOGENOMiHOG000049129.
    HOVERGENiHBG050676.
    OrthoDBiEOG75MVVN.

    Family and domain databases

    Gene3Di2.130.10.10. 2 hits.
    InterProiIPR022175. BCAS3.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR017986. WD40_repeat_dom.
    [Graphical view]
    PfamiPF12490. BCAS3. 1 hit.
    [Graphical view]
    SMARTiSM00320. WD40. 2 hits.
    [Graphical view]
    SUPFAMiSSF50978. SSF50978. 2 hits.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8CCN5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MNETMATDSP RRPSRCTGGV VVRPQAVTEQ SYMESVVTFL QDVVPQAYSG    50
    SPLTEEKEKI VWVRFENADL NDTSRNLEFH ELHSTGNEPP LLVMIGYSDG 100
    MQVWGIPISG EAQELFSVRH GPVRAARILP APQLGAQKCD NFAEKRPLLG 150
    VCKSIGSSGT TPPYCCVDLY SLRTGEMVKS IQFKTPIYDL HCNKRILVVV 200
    LQEKIAAFDS CTFTKKFFVT SCYPCPGPNM NPIALGSRWL AYAENKLIRC 250
    HQSRGGACGD NIQSYTATVL SAAKTLKSGL TMVGKVVTQL TGTLPSGVTE 300
    DDVALHCNSR RSPLVPGIIT VIDTETVGEG QVLVSEDSDS DGIVAHFPAH 350
    EKPVCCMAFN TSGMLLVTTD TLGHDFHVFQ ILTHPWSSSQ CAVHHLYTLH 400
    RGETEAKVQD ICFSHDCRWV VVSTLRGTSH VFPINPYGGQ PCVRTHMSPR 450
    VVNRMSRFQK SAGLEEIEQE LTSKQGGRCS PVPGLSSSPS GSPLHGKLTS 500
    QDSYNNFTNN NPGNPRLSPL PSLMVVTPLA QIKQPMTLGT ITKRTGPYLF 550
    GAGCFSIKAP CKVKSPPQIS PSKSMGGEFC VAAVFGTSRS WFANNAGLKR 600
    EKDQSKQVVV ESLYIISCYG TLVEHMIEPR PISTAPKISD DTPLEIMTSP 650
    RASWTLVRTP QWNELQPPFN ANHPLLLAAE AVQYYQLLLA GSLPPGSPGP 700
    ITRHGSYDSL ASDHSGQEDE EWLSQVEIVT HTGPHRRLWM GPQFHFKTIQ 750
    TSGQTTVIST SSSVLQSHGP SDTPQPLLDF DTDDLDLNSL RIQPVRSDPV 800
    SMPGSSRAVS DRRGVSTVTD AASGTFDRSV TLLEVCGSWP EGFGLRHMSS 850
    MEHSEEGLRE RLADAMAESP SRDVVGSGTE LQREGSIETL SNSSGSTSGS 900
    IPRNFDGYRS PLPTNESQPL SLFPTGFP 928
    Length:928
    Mass (Da):101,021
    Last modified:July 25, 2003 - v2
    Checksum:iEF8FE46CF7011A7B
    GO
    Isoform 2 (identifier: Q8CCN5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         498-527: LTSQDSYNNFTNNNPGNPRLSPLPSLMVVT → HFPLMLLSSRFLLYHLGSDANFYSVCAEHS
         528-928: Missing.

    Note: Due to an intron retention.

    Show »
    Length:527
    Mass (Da):57,719
    Checksum:iF4F4A2004EF5975D
    GO

    Sequence cautioni

    The sequence AAG34697.1 differs from that shown. Reason: Erroneous termination at position 388. Translated as Ser.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti75 – 751R → Q in BAC27862. (PubMed:16141072)Curated
    Sequence conflicti472 – 4721T → D1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei498 – 52730LTSQD…LMVVT → HFPLMLLSSRFLLYHLGSDA NFYSVCAEHS in isoform 2. 1 PublicationVSP_007861Add
    BLAST
    Alternative sequencei528 – 928401Missing in isoform 2. 1 PublicationVSP_007862Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK032423 mRNA. Translation: BAC27862.1.
    AK034117 mRNA. Translation: BAC28592.1.
    AF313800 mRNA. Translation: AAG34697.1. Sequence problems.
    CCDSiCCDS25195.1. [Q8CCN5-1]
    RefSeqiNP_001160114.1. NM_001166642.1.
    NP_619622.3. NM_138681.4. [Q8CCN5-1]
    XP_006532603.1. XM_006532540.1. [Q8CCN5-1]
    UniGeneiMm.287663.

    Genome annotation databases

    EnsembliENSMUST00000074875; ENSMUSP00000074416; ENSMUSG00000059439. [Q8CCN5-1]
    ENSMUST00000108056; ENSMUSP00000103691; ENSMUSG00000059439. [Q8CCN5-2]
    GeneIDi192197.
    KEGGimmu:192197.
    UCSCiuc007krp.2. mouse. [Q8CCN5-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK032423 mRNA. Translation: BAC27862.1 .
    AK034117 mRNA. Translation: BAC28592.1 .
    AF313800 mRNA. Translation: AAG34697.1 . Sequence problems.
    CCDSi CCDS25195.1. [Q8CCN5-1 ]
    RefSeqi NP_001160114.1. NM_001166642.1.
    NP_619622.3. NM_138681.4. [Q8CCN5-1 ]
    XP_006532603.1. XM_006532540.1. [Q8CCN5-1 ]
    UniGenei Mm.287663.

    3D structure databases

    ProteinModelPortali Q8CCN5.
    SMRi Q8CCN5. Positions 167-192, 345-373.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei Q8CCN5.

    Proteomic databases

    MaxQBi Q8CCN5.
    PaxDbi Q8CCN5.
    PRIDEi Q8CCN5.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000074875 ; ENSMUSP00000074416 ; ENSMUSG00000059439 . [Q8CCN5-1 ]
    ENSMUST00000108056 ; ENSMUSP00000103691 ; ENSMUSG00000059439 . [Q8CCN5-2 ]
    GeneIDi 192197.
    KEGGi mmu:192197.
    UCSCi uc007krp.2. mouse. [Q8CCN5-1 ]

    Organism-specific databases

    CTDi 54828.
    MGIi MGI:2385848. Bcas3.

    Phylogenomic databases

    eggNOGi NOG321894.
    GeneTreei ENSGT00390000006454.
    HOGENOMi HOG000049129.
    HOVERGENi HBG050676.
    OrthoDBi EOG75MVVN.

    Miscellaneous databases

    NextBioi 371234.
    PROi Q8CCN5.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8CCN5.
    Bgeei Q8CCN5.
    CleanExi MM_BCAS3.
    Genevestigatori Q8CCN5.

    Family and domain databases

    Gene3Di 2.130.10.10. 2 hits.
    InterProi IPR022175. BCAS3.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR017986. WD40_repeat_dom.
    [Graphical view ]
    Pfami PF12490. BCAS3. 1 hit.
    [Graphical view ]
    SMARTi SM00320. WD40. 2 hits.
    [Graphical view ]
    SUPFAMi SSF50978. SSF50978. 2 hits.
    ProtoNeti Search...

    Publicationsi

    1. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Strain: C57BL/6J.
      Tissue: Diencephalon and Olfactory bulb.
    2. "A gene trap clone K20D4 is expressed during vascular development."
      Inamdar M.S.
      Submitted (OCT-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-477 (ISOFORM 1).
    3. Cited for: TISSUE SPECIFICITY.
    4. Erratum
      Gururaj A.E., Singh R.R., Rayala S.K., Holm C., den Hollander P., Zhang H., Balasenthil S., Talukder A.H., Landberg G., Kumar R.
      Proc. Natl. Acad. Sci. U.S.A. 110:4147-4148(2013)
    5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-480, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Liver.

    Entry informationi

    Entry nameiBCAS3_MOUSE
    AccessioniPrimary (citable) accession number: Q8CCN5
    Secondary accession number(s): Q8CC16, Q9EPX3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 25, 2003
    Last sequence update: July 25, 2003
    Last modified: October 1, 2014
    This is version 97 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3