SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8CCF0

- PRP31_MOUSE

UniProt

Q8CCF0 - PRP31_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

U4/U6 small nuclear ribonucleoprotein Prp31

Gene
Prpf31, Prp31
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Involved in pre-mRNA splicing. Required for the assembly of the U4/U5/U6 tri-snRNP complex, one of the building blocks of the spliceosome By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei247 – 2471Interaction with U4 snRNA By similarity
Sitei270 – 2701Interaction with U4 snRNA By similarity

GO - Molecular functioni

  1. ribonucleoprotein complex binding Source: MGI
  2. RNA binding Source: UniProtKB-KW
  3. snRNP binding Source: Ensembl

GO - Biological processi

  1. mRNA splicing, via spliceosome Source: MGI
  2. spliceosomal tri-snRNP complex assembly Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Ribonucleoprotein

Keywords - Biological processi

mRNA processing, mRNA splicing

Keywords - Ligandi

RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
U4/U6 small nuclear ribonucleoprotein Prp31
Alternative name(s):
Pre-mRNA-processing factor 31
U4/U6 snRNP 61 kDa protein
Short name:
Protein 61K
Gene namesi
Name:Prpf31
Synonyms:Prp31
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 7

Organism-specific databases

MGIiMGI:1916238. Prpf31.

Subcellular locationi

Nucleus speckle By similarity. NucleusCajal body By similarity
Note: Predominantly found in speckles and in Cajal bodies By similarity.

GO - Cellular componenti

  1. Cajal body Source: MGI
  2. MLL1 complex Source: UniProtKB
  3. nuclear speck Source: MGI
  4. spliceosomal complex Source: UniProtKB-KW
  5. U4/U6 x U5 tri-snRNP complex Source: MGI
  6. U4 snRNP Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Nucleus, Spliceosome

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 499499U4/U6 small nuclear ribonucleoprotein Prp31PRO_0000227800Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei379 – 3791Phosphoserine By similarity
Modified residuei438 – 4381N6-acetyllysine1 Publication
Modified residuei450 – 4501Phosphoserine By similarity
Modified residuei455 – 4551Phosphothreonine By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ8CCF0.
PaxDbiQ8CCF0.
PRIDEiQ8CCF0.

PTM databases

PhosphoSiteiQ8CCF0.

Expressioni

Gene expression databases

BgeeiQ8CCF0.
GenevestigatoriQ8CCF0.

Interactioni

Subunit structurei

Component of the U4/U6-U5 tri-snRNP complex composed of the U4, U6 and U5 snRNAs and at least PRPF3, PRPF4, PRPF6, PRPF8, PRPF31, SNRNP200, TXNL4A, SNRNP40, DDX23, CD2BP2, PPIH, NHP2L1, EFTUD2, SART1 and USP39. Interacts with a complex formed by NHP2L1 and U4 snRNA, but not with NHP2L1 or U4 snRNA alone. Interacts with PRPF6/U5 snRNP-associated 102 kDa protein. Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, MYST1/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10. Interacts (via its NLS) with CTNNBL1 By similarity.

Protein-protein interaction databases

BioGridi213160. 2 interactions.
IntActiQ8CCF0. 1 interaction.
MINTiMINT-4115085.

Structurei

3D structure databases

ProteinModelPortaliQ8CCF0.
SMRiQ8CCF0. Positions 86-332.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini215 – 333119NopAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni351 – 36414Nuclear localization signal (NLS) By similarityAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili85 – 12036 By similarityAdd
BLAST
Coiled coili181 – 21535 By similarityAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi16 – 194Poly-Glu
Compositional biasi25 – 295Poly-Glu

Domaini

Interacts with the snRNP via the Nop domain By similarity.
The coiled coil domain is formed by two non-contiguous helices By similarity.

Sequence similaritiesi

Belongs to the PRP31 family.
Contains 1 Nop domain.

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiCOG1498.
GeneTreeiENSGT00550000075069.
HOVERGENiHBG082193.
InParanoidiQ8CCF0.
KOiK12844.
OMAiRKHANRM.
OrthoDBiEOG7RJPRF.
TreeFamiTF300677.

Family and domain databases

InterProiIPR002687. Nop_dom.
IPR012976. NOSIC.
IPR027105. Prp31.
IPR019175. Prp31_C.
[Graphical view]
PANTHERiPTHR13904. PTHR13904. 1 hit.
PfamiPF01798. Nop. 1 hit.
PF08060. NOSIC. 1 hit.
PF09785. Prp31_C. 1 hit.
[Graphical view]
SMARTiSM00931. NOSIC. 1 hit.
[Graphical view]
PROSITEiPS51358. NOP. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8CCF0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSLADELLAD LEEAAEEEEG GSYGEEEEEP AIEDVQEETQ LDLSGDSVKS    50
IAKLWDSKMF AEIMMKIEEY ISKQANVSEV MGPVEAAPEY RVIVDANNLT 100
VEIENELNII HKFIRDKYSK RFPELESLVP NALDYIRTVK ELGNSLDKCK 150
NNENLQQILT NATIMVVSVT ASTTQGQQLS DEELERLEEA CDMALELNAS 200
KHRIYEYVES RMSFIAPNLS IIIGASTAAK IMGVAGGLTN LSKMPACNIM 250
LLGAQRKTLS GFSSTSVLPH TGYIYHSDIV QSLPPDLRRK AARLVAAKCT 300
LAARVDSFHE STEGKVGYEL KDEIERKFDK WQEPPPVKQV KPLPAPLDGQ 350
RKKRGGRRYR KMKERLGLTE IRKQANRMSF GEIEEDAYQE DLGFSLGHLG 400
KSGSGRVRQT QVNEATKARI SKTLQRTLQK QSVVYGGKST IRDRSSGTAS 450
SVAFTPLQGL EIVNPQAAEK KVAEANQKYF SSMAEFLKVK GEKSGTMST 499
Length:499
Mass (Da):55,430
Last modified:July 27, 2011 - v3
Checksum:iA8149257A6213D4F
GO
Isoform 2 (identifier: Q8CCF0-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     316-321: Missing.

Note: No experimental confirmation available.

Show »
Length:493
Mass (Da):54,740
Checksum:i4D95CBC24749FA1A
GO
Isoform 3 (identifier: Q8CCF0-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MSLADE → MS

Note: No experimental confirmation available.

Show »
Length:495
Mass (Da):55,001
Checksum:i089E1E6B046F7617
GO
Isoform 4 (identifier: Q8CCF0-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-59: MSLADELLADLEEAAEEEEGGSYGEEEEEPAIEDVQEETQLDLSGDSVKSIAKLWDSKM → MGQQDGE
     234-247: VAGGLTNLSKMPAC → EVPAGSLWQSLLIG
     248-499: Missing.

Note: No experimental confirmation available.

Show »
Length:195
Mass (Da):21,800
Checksum:i20F419708DFBDE89
GO
Isoform 5 (identifier: Q8CCF0-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     177-185: QQLSDEELE → GSPLQVNQD
     186-499: Missing.

Note: No experimental confirmation available.

Show »
Length:185
Mass (Da):20,644
Checksum:i95A88E010E2F42DA
GO

Sequence cautioni

The sequence BAC25109.1 differs from that shown. Reason: Frameshift at position 357.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5959MSLAD…WDSKM → MGQQDGE in isoform 4. VSP_017585Add
BLAST
Alternative sequencei1 – 66MSLADE → MS in isoform 3. VSP_017586
Alternative sequencei177 – 1859QQLSDEELE → GSPLQVNQD in isoform 5. VSP_017587
Alternative sequencei186 – 499314Missing in isoform 5. VSP_017588Add
BLAST
Alternative sequencei234 – 24714VAGGL…KMPAC → EVPAGSLWQSLLIG in isoform 4. VSP_017589Add
BLAST
Alternative sequencei248 – 499252Missing in isoform 4. VSP_017590Add
BLAST
Alternative sequencei316 – 3216Missing in isoform 2. VSP_017591

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti77 – 771V → A in AAK77987. 1 Publication
Sequence conflicti77 – 771V → A in BAC31931. 1 Publication
Sequence conflicti77 – 771V → A in CAJ18397. 1 Publication
Sequence conflicti77 – 771V → A in AAH18376. 1 Publication
Sequence conflicti77 – 771V → A in AAH57877. 1 Publication
Sequence conflicti104 – 1041E → V in BAC28192. 1 Publication
Sequence conflicti177 – 1771Q → R in BAC28220. 1 Publication
Sequence conflicti177 – 1771Q → R in BAC28192. 1 Publication
Sequence conflicti382 – 3821E → G in BAC25109. 1 Publication
Sequence conflicti481 – 4811S → F in AAH61461. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY040823 mRNA. Translation: AAK77987.1.
AK005294 mRNA. Translation: BAC25109.1. Frameshift.
AK033190 mRNA. Translation: BAC28192.1.
AK033283 mRNA. Translation: BAC28220.1.
AK044398 mRNA. Translation: BAC31903.1.
AK044457 mRNA. Translation: BAC31931.1.
AK051260 mRNA. Translation: BAC34578.1.
CT010189 mRNA. Translation: CAJ18397.1.
AC130680 Genomic DNA. No translation available.
BC018376 mRNA. Translation: AAH18376.1.
BC057877 mRNA. Translation: AAH57877.1.
BC061461 mRNA. Translation: AAH61461.1.
CCDSiCCDS39729.1. [Q8CCF0-1]
CCDS51965.1. [Q8CCF0-2]
RefSeqiNP_001153186.1. NM_001159714.1. [Q8CCF0-2]
NP_081604.3. NM_027328.4. [Q8CCF0-1]
XP_006540409.1. XM_006540346.1. [Q8CCF0-1]
UniGeneiMm.246863.

Genome annotation databases

EnsembliENSMUST00000008517; ENSMUSP00000008517; ENSMUSG00000008373. [Q8CCF0-1]
ENSMUST00000108636; ENSMUSP00000104276; ENSMUSG00000008373. [Q8CCF0-2]
ENSMUST00000179769; ENSMUSP00000136031; ENSMUSG00000008373. [Q8CCF0-2]
GeneIDi68988.
KEGGimmu:68988.
UCSCiuc009evi.2. mouse. [Q8CCF0-1]
uc012ewf.1. mouse. [Q8CCF0-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY040823 mRNA. Translation: AAK77987.1 .
AK005294 mRNA. Translation: BAC25109.1 . Frameshift.
AK033190 mRNA. Translation: BAC28192.1 .
AK033283 mRNA. Translation: BAC28220.1 .
AK044398 mRNA. Translation: BAC31903.1 .
AK044457 mRNA. Translation: BAC31931.1 .
AK051260 mRNA. Translation: BAC34578.1 .
CT010189 mRNA. Translation: CAJ18397.1 .
AC130680 Genomic DNA. No translation available.
BC018376 mRNA. Translation: AAH18376.1 .
BC057877 mRNA. Translation: AAH57877.1 .
BC061461 mRNA. Translation: AAH61461.1 .
CCDSi CCDS39729.1. [Q8CCF0-1 ]
CCDS51965.1. [Q8CCF0-2 ]
RefSeqi NP_001153186.1. NM_001159714.1. [Q8CCF0-2 ]
NP_081604.3. NM_027328.4. [Q8CCF0-1 ]
XP_006540409.1. XM_006540346.1. [Q8CCF0-1 ]
UniGenei Mm.246863.

3D structure databases

ProteinModelPortali Q8CCF0.
SMRi Q8CCF0. Positions 86-332.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 213160. 2 interactions.
IntActi Q8CCF0. 1 interaction.
MINTi MINT-4115085.

PTM databases

PhosphoSitei Q8CCF0.

Proteomic databases

MaxQBi Q8CCF0.
PaxDbi Q8CCF0.
PRIDEi Q8CCF0.

Protocols and materials databases

DNASUi 68988.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000008517 ; ENSMUSP00000008517 ; ENSMUSG00000008373 . [Q8CCF0-1 ]
ENSMUST00000108636 ; ENSMUSP00000104276 ; ENSMUSG00000008373 . [Q8CCF0-2 ]
ENSMUST00000179769 ; ENSMUSP00000136031 ; ENSMUSG00000008373 . [Q8CCF0-2 ]
GeneIDi 68988.
KEGGi mmu:68988.
UCSCi uc009evi.2. mouse. [Q8CCF0-1 ]
uc012ewf.1. mouse. [Q8CCF0-2 ]

Organism-specific databases

CTDi 26121.
MGIi MGI:1916238. Prpf31.

Phylogenomic databases

eggNOGi COG1498.
GeneTreei ENSGT00550000075069.
HOVERGENi HBG082193.
InParanoidi Q8CCF0.
KOi K12844.
OMAi RKHANRM.
OrthoDBi EOG7RJPRF.
TreeFami TF300677.

Miscellaneous databases

NextBioi 328355.
PROi Q8CCF0.
SOURCEi Search...

Gene expression databases

Bgeei Q8CCF0.
Genevestigatori Q8CCF0.

Family and domain databases

InterProi IPR002687. Nop_dom.
IPR012976. NOSIC.
IPR027105. Prp31.
IPR019175. Prp31_C.
[Graphical view ]
PANTHERi PTHR13904. PTHR13904. 1 hit.
Pfami PF01798. Nop. 1 hit.
PF08060. NOSIC. 1 hit.
PF09785. Prp31_C. 1 hit.
[Graphical view ]
SMARTi SM00931. NOSIC. 1 hit.
[Graphical view ]
PROSITEi PS51358. NOP. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Protein 61K, encoded by a gene (PRPF31) linked to autosomal dominant retinitis pigmentosa, is required for U4/U6.U5 tri-snRNP formation and pre-mRNA splicing."
    Makarova O.V., Makarov E.M., Liu S., Vornlocher H.-P., Luehrmann R.
    EMBO J. 21:1148-1157(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: C57BL/6J X CBA/J.
    Tissue: Lung.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 4 AND 5).
    Strain: C57BL/6J.
    Tissue: Cerebellum, Retina, Spinal ganglion and Testis.
  3. "Cloning of mouse full open reading frames in Gateway(R) system entry vector (pDONR201)."
    Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J., Wiemann S., Schick M., Korn B.
    Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: FVB/N and NMRI.
    Tissue: Brain and Mammary tumor.
  6. "SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways."
    Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.
    Mol. Cell 50:919-930(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-438, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic fibroblast.

Entry informationi

Entry nameiPRP31_MOUSE
AccessioniPrimary (citable) accession number: Q8CCF0
Secondary accession number(s): E9QPM6
, Q6P7X2, Q8BQ91, Q8C8U4, Q8C8V5, Q8CCG6, Q8CF52, Q8VBW3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: July 27, 2011
Last modified: July 9, 2014
This is version 97 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi