Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8CCF0 (PRP31_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 97. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
U4/U6 small nuclear ribonucleoprotein Prp31
Alternative name(s):
Pre-mRNA-processing factor 31
U4/U6 snRNP 61 kDa protein
Short name=Protein 61K
Gene names
Name:Prpf31
Synonyms:Prp31
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length499 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Involved in pre-mRNA splicing. Required for the assembly of the U4/U5/U6 tri-snRNP complex, one of the building blocks of the spliceosome By similarity.

Subunit structure

Component of the U4/U6-U5 tri-snRNP complex composed of the U4, U6 and U5 snRNAs and at least PRPF3, PRPF4, PRPF6, PRPF8, PRPF31, SNRNP200, TXNL4A, SNRNP40, DDX23, CD2BP2, PPIH, NHP2L1, EFTUD2, SART1 and USP39. Interacts with a complex formed by NHP2L1 and U4 snRNA, but not with NHP2L1 or U4 snRNA alone. Interacts with PRPF6/U5 snRNP-associated 102 kDa protein. Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, MYST1/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10. Interacts (via its NLS) with CTNNBL1 By similarity.

Subcellular location

Nucleus speckle By similarity. NucleusCajal body By similarity. Note: Predominantly found in speckles and in Cajal bodies By similarity.

Domain

Interacts with the snRNP via the Nop domain By similarity.

The coiled coil domain is formed by two non-contiguous helices By similarity.

Sequence similarities

Belongs to the PRP31 family.

Contains 1 Nop domain.

Sequence caution

The sequence BAC25109.1 differs from that shown. Reason: Frameshift at position 357.

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8CCF0-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8CCF0-2)

The sequence of this isoform differs from the canonical sequence as follows:
     316-321: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q8CCF0-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MSLADE → MS
Note: No experimental confirmation available.
Isoform 4 (identifier: Q8CCF0-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-59: MSLADELLADLEEAAEEEEGGSYGEEEEEPAIEDVQEETQLDLSGDSVKSIAKLWDSKM → MGQQDGE
     234-247: VAGGLTNLSKMPAC → EVPAGSLWQSLLIG
     248-499: Missing.
Note: No experimental confirmation available.
Isoform 5 (identifier: Q8CCF0-5)

The sequence of this isoform differs from the canonical sequence as follows:
     177-185: QQLSDEELE → GSPLQVNQD
     186-499: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 499499U4/U6 small nuclear ribonucleoprotein Prp31
PRO_0000227800

Regions

Domain215 – 333119Nop
Region351 – 36414Nuclear localization signal (NLS) By similarity
Coiled coil85 – 12036 By similarity
Coiled coil181 – 21535 By similarity
Compositional bias16 – 194Poly-Glu
Compositional bias25 – 295Poly-Glu

Sites

Site2471Interaction with U4 snRNA By similarity
Site2701Interaction with U4 snRNA By similarity

Amino acid modifications

Modified residue3791Phosphoserine By similarity
Modified residue4381N6-acetyllysine Ref.6
Modified residue4501Phosphoserine By similarity
Modified residue4551Phosphothreonine By similarity

Natural variations

Alternative sequence1 – 5959MSLAD…WDSKM → MGQQDGE in isoform 4.
VSP_017585
Alternative sequence1 – 66MSLADE → MS in isoform 3.
VSP_017586
Alternative sequence177 – 1859QQLSDEELE → GSPLQVNQD in isoform 5.
VSP_017587
Alternative sequence186 – 499314Missing in isoform 5.
VSP_017588
Alternative sequence234 – 24714VAGGL…KMPAC → EVPAGSLWQSLLIG in isoform 4.
VSP_017589
Alternative sequence248 – 499252Missing in isoform 4.
VSP_017590
Alternative sequence316 – 3216Missing in isoform 2.
VSP_017591

Experimental info

Sequence conflict771V → A in AAK77987. Ref.1
Sequence conflict771V → A in BAC31931. Ref.2
Sequence conflict771V → A in CAJ18397. Ref.3
Sequence conflict771V → A in AAH18376. Ref.5
Sequence conflict771V → A in AAH57877. Ref.5
Sequence conflict1041E → V in BAC28192. Ref.2
Sequence conflict1771Q → R in BAC28220. Ref.2
Sequence conflict1771Q → R in BAC28192. Ref.2
Sequence conflict3821E → G in BAC25109. Ref.2
Sequence conflict4811S → F in AAH61461. Ref.5

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 27, 2011. Version 3.
Checksum: A8149257A6213D4F

FASTA49955,430
        10         20         30         40         50         60 
MSLADELLAD LEEAAEEEEG GSYGEEEEEP AIEDVQEETQ LDLSGDSVKS IAKLWDSKMF 

        70         80         90        100        110        120 
AEIMMKIEEY ISKQANVSEV MGPVEAAPEY RVIVDANNLT VEIENELNII HKFIRDKYSK 

       130        140        150        160        170        180 
RFPELESLVP NALDYIRTVK ELGNSLDKCK NNENLQQILT NATIMVVSVT ASTTQGQQLS 

       190        200        210        220        230        240 
DEELERLEEA CDMALELNAS KHRIYEYVES RMSFIAPNLS IIIGASTAAK IMGVAGGLTN 

       250        260        270        280        290        300 
LSKMPACNIM LLGAQRKTLS GFSSTSVLPH TGYIYHSDIV QSLPPDLRRK AARLVAAKCT 

       310        320        330        340        350        360 
LAARVDSFHE STEGKVGYEL KDEIERKFDK WQEPPPVKQV KPLPAPLDGQ RKKRGGRRYR 

       370        380        390        400        410        420 
KMKERLGLTE IRKQANRMSF GEIEEDAYQE DLGFSLGHLG KSGSGRVRQT QVNEATKARI 

       430        440        450        460        470        480 
SKTLQRTLQK QSVVYGGKST IRDRSSGTAS SVAFTPLQGL EIVNPQAAEK KVAEANQKYF 

       490 
SSMAEFLKVK GEKSGTMST 

« Hide

Isoform 2 [UniParc].

Checksum: 4D95CBC24749FA1A
Show »

FASTA49354,740
Isoform 3 [UniParc].

Checksum: 089E1E6B046F7617
Show »

FASTA49555,001
Isoform 4 [UniParc].

Checksum: 20F419708DFBDE89
Show »

FASTA19521,800
Isoform 5 [UniParc].

Checksum: 95A88E010E2F42DA
Show »

FASTA18520,644

References

« Hide 'large scale' references
[1]"Protein 61K, encoded by a gene (PRPF31) linked to autosomal dominant retinitis pigmentosa, is required for U4/U6.U5 tri-snRNP formation and pre-mRNA splicing."
Makarova O.V., Makarov E.M., Liu S., Vornlocher H.-P., Luehrmann R.
EMBO J. 21:1148-1157(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Strain: C57BL/6J X CBA/J.
Tissue: Lung.
[2]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 4 AND 5).
Strain: C57BL/6J.
Tissue: Cerebellum, Retina, Spinal ganglion and Testis.
[3]"Cloning of mouse full open reading frames in Gateway(R) system entry vector (pDONR201)."
Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J., Wiemann S., Schick M., Korn B.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[4]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Strain: FVB/N and NMRI.
Tissue: Brain and Mammary tumor.
[6]"SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways."
Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.
Mol. Cell 50:919-930(2013) [PubMed] [Europe PMC] [Abstract]
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-438, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Embryonic fibroblast.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY040823 mRNA. Translation: AAK77987.1.
AK005294 mRNA. Translation: BAC25109.1. Frameshift.
AK033190 mRNA. Translation: BAC28192.1.
AK033283 mRNA. Translation: BAC28220.1.
AK044398 mRNA. Translation: BAC31903.1.
AK044457 mRNA. Translation: BAC31931.1.
AK051260 mRNA. Translation: BAC34578.1.
CT010189 mRNA. Translation: CAJ18397.1.
AC130680 Genomic DNA. No translation available.
BC018376 mRNA. Translation: AAH18376.1.
BC057877 mRNA. Translation: AAH57877.1.
BC061461 mRNA. Translation: AAH61461.1.
CCDSCCDS39729.1. [Q8CCF0-1]
CCDS51965.1. [Q8CCF0-2]
RefSeqNP_001153186.1. NM_001159714.1. [Q8CCF0-2]
NP_081604.3. NM_027328.4. [Q8CCF0-1]
XP_006540409.1. XM_006540346.1. [Q8CCF0-1]
UniGeneMm.246863.

3D structure databases

ProteinModelPortalQ8CCF0.
SMRQ8CCF0. Positions 86-332.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid213160. 2 interactions.
IntActQ8CCF0. 1 interaction.
MINTMINT-4115085.

PTM databases

PhosphoSiteQ8CCF0.

Proteomic databases

MaxQBQ8CCF0.
PaxDbQ8CCF0.
PRIDEQ8CCF0.

Protocols and materials databases

DNASU68988.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000008517; ENSMUSP00000008517; ENSMUSG00000008373. [Q8CCF0-1]
ENSMUST00000108636; ENSMUSP00000104276; ENSMUSG00000008373. [Q8CCF0-2]
ENSMUST00000179769; ENSMUSP00000136031; ENSMUSG00000008373. [Q8CCF0-2]
GeneID68988.
KEGGmmu:68988.
UCSCuc009evi.2. mouse. [Q8CCF0-1]
uc012ewf.1. mouse. [Q8CCF0-2]

Organism-specific databases

CTD26121.
MGIMGI:1916238. Prpf31.

Phylogenomic databases

eggNOGCOG1498.
GeneTreeENSGT00550000075069.
HOVERGENHBG082193.
InParanoidQ8CCF0.
KOK12844.
OMARKHANRM.
OrthoDBEOG7RJPRF.
TreeFamTF300677.

Gene expression databases

BgeeQ8CCF0.
GenevestigatorQ8CCF0.

Family and domain databases

InterProIPR002687. Nop_dom.
IPR012976. NOSIC.
IPR027105. Prp31.
IPR019175. Prp31_C.
[Graphical view]
PANTHERPTHR13904. PTHR13904. 1 hit.
PfamPF01798. Nop. 1 hit.
PF08060. NOSIC. 1 hit.
PF09785. Prp31_C. 1 hit.
[Graphical view]
SMARTSM00931. NOSIC. 1 hit.
[Graphical view]
PROSITEPS51358. NOP. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio328355.
PROQ8CCF0.
SOURCESearch...

Entry information

Entry namePRP31_MOUSE
AccessionPrimary (citable) accession number: Q8CCF0
Secondary accession number(s): E9QPM6 expand/collapse secondary AC list , Q6P7X2, Q8BQ91, Q8C8U4, Q8C8V5, Q8CCG6, Q8CF52, Q8VBW3
Entry history
Integrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: July 27, 2011
Last modified: July 9, 2014
This is version 97 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot