Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8CCF0

- PRP31_MOUSE

UniProt

Q8CCF0 - PRP31_MOUSE

Protein

U4/U6 small nuclear ribonucleoprotein Prp31

Gene

Prpf31

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 98 (01 Oct 2014)
      Sequence version 3 (27 Jul 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Involved in pre-mRNA splicing. Required for the assembly of the U4/U5/U6 tri-snRNP complex, one of the building blocks of the spliceosome By similarity.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei247 – 2471Interaction with U4 snRNABy similarity
    Sitei270 – 2701Interaction with U4 snRNABy similarity

    GO - Molecular functioni

    1. ribonucleoprotein complex binding Source: MGI
    2. RNA binding Source: UniProtKB-KW
    3. snRNP binding Source: Ensembl

    GO - Biological processi

    1. mRNA splicing, via spliceosome Source: MGI
    2. spliceosomal tri-snRNP complex assembly Source: MGI

    Keywords - Molecular functioni

    Ribonucleoprotein

    Keywords - Biological processi

    mRNA processing, mRNA splicing

    Keywords - Ligandi

    RNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    U4/U6 small nuclear ribonucleoprotein Prp31
    Alternative name(s):
    Pre-mRNA-processing factor 31
    U4/U6 snRNP 61 kDa protein
    Short name:
    Protein 61K
    Gene namesi
    Name:Prpf31
    Synonyms:Prp31
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 7

    Organism-specific databases

    MGIiMGI:1916238. Prpf31.

    Subcellular locationi

    Nucleus speckle By similarity. NucleusCajal body By similarity
    Note: Predominantly found in speckles and in Cajal bodies.By similarity

    GO - Cellular componenti

    1. Cajal body Source: MGI
    2. MLL1 complex Source: UniProtKB
    3. nuclear speck Source: MGI
    4. spliceosomal complex Source: UniProtKB-KW
    5. U4/U6 x U5 tri-snRNP complex Source: MGI
    6. U4 snRNP Source: Ensembl

    Keywords - Cellular componenti

    Nucleus, Spliceosome

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 499499U4/U6 small nuclear ribonucleoprotein Prp31PRO_0000227800Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei379 – 3791PhosphoserineBy similarity
    Modified residuei438 – 4381N6-acetyllysine1 Publication
    Modified residuei450 – 4501PhosphoserineBy similarity
    Modified residuei455 – 4551PhosphothreonineBy similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ8CCF0.
    PaxDbiQ8CCF0.
    PRIDEiQ8CCF0.

    PTM databases

    PhosphoSiteiQ8CCF0.

    Expressioni

    Gene expression databases

    BgeeiQ8CCF0.
    GenevestigatoriQ8CCF0.

    Interactioni

    Subunit structurei

    Component of the U4/U6-U5 tri-snRNP complex composed of the U4, U6 and U5 snRNAs and at least PRPF3, PRPF4, PRPF6, PRPF8, PRPF31, SNRNP200, TXNL4A, SNRNP40, DDX23, CD2BP2, PPIH, NHP2L1, EFTUD2, SART1 and USP39. Interacts with a complex formed by NHP2L1 and U4 snRNA, but not with NHP2L1 or U4 snRNA alone. Interacts with PRPF6/U5 snRNP-associated 102 kDa protein. Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, MYST1/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10. Interacts (via its NLS) with CTNNBL1 By similarity.By similarity

    Protein-protein interaction databases

    BioGridi213160. 2 interactions.
    IntActiQ8CCF0. 1 interaction.
    MINTiMINT-4115085.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8CCF0.
    SMRiQ8CCF0. Positions 86-332.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini215 – 333119NopPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni351 – 36414Nuclear localization signal (NLS)By similarityAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili85 – 12036By similarityAdd
    BLAST
    Coiled coili181 – 21535By similarityAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi16 – 194Poly-Glu
    Compositional biasi25 – 295Poly-Glu

    Domaini

    Interacts with the snRNP via the Nop domain.By similarity
    The coiled coil domain is formed by two non-contiguous helices.By similarity

    Sequence similaritiesi

    Belongs to the PRP31 family.Curated
    Contains 1 Nop domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiCOG1498.
    GeneTreeiENSGT00550000075069.
    HOVERGENiHBG082193.
    InParanoidiQ8CCF0.
    KOiK12844.
    OMAiRKHANRM.
    OrthoDBiEOG7RJPRF.
    TreeFamiTF300677.

    Family and domain databases

    InterProiIPR002687. Nop_dom.
    IPR012976. NOSIC.
    IPR027105. Prp31.
    IPR019175. Prp31_C.
    [Graphical view]
    PANTHERiPTHR13904. PTHR13904. 1 hit.
    PfamiPF01798. Nop. 1 hit.
    PF08060. NOSIC. 1 hit.
    PF09785. Prp31_C. 1 hit.
    [Graphical view]
    SMARTiSM00931. NOSIC. 1 hit.
    [Graphical view]
    PROSITEiPS51358. NOP. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8CCF0-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSLADELLAD LEEAAEEEEG GSYGEEEEEP AIEDVQEETQ LDLSGDSVKS    50
    IAKLWDSKMF AEIMMKIEEY ISKQANVSEV MGPVEAAPEY RVIVDANNLT 100
    VEIENELNII HKFIRDKYSK RFPELESLVP NALDYIRTVK ELGNSLDKCK 150
    NNENLQQILT NATIMVVSVT ASTTQGQQLS DEELERLEEA CDMALELNAS 200
    KHRIYEYVES RMSFIAPNLS IIIGASTAAK IMGVAGGLTN LSKMPACNIM 250
    LLGAQRKTLS GFSSTSVLPH TGYIYHSDIV QSLPPDLRRK AARLVAAKCT 300
    LAARVDSFHE STEGKVGYEL KDEIERKFDK WQEPPPVKQV KPLPAPLDGQ 350
    RKKRGGRRYR KMKERLGLTE IRKQANRMSF GEIEEDAYQE DLGFSLGHLG 400
    KSGSGRVRQT QVNEATKARI SKTLQRTLQK QSVVYGGKST IRDRSSGTAS 450
    SVAFTPLQGL EIVNPQAAEK KVAEANQKYF SSMAEFLKVK GEKSGTMST 499
    Length:499
    Mass (Da):55,430
    Last modified:July 27, 2011 - v3
    Checksum:iA8149257A6213D4F
    GO
    Isoform 2 (identifier: Q8CCF0-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         316-321: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:493
    Mass (Da):54,740
    Checksum:i4D95CBC24749FA1A
    GO
    Isoform 3 (identifier: Q8CCF0-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-6: MSLADE → MS

    Note: No experimental confirmation available.

    Show »
    Length:495
    Mass (Da):55,001
    Checksum:i089E1E6B046F7617
    GO
    Isoform 4 (identifier: Q8CCF0-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-59: MSLADELLADLEEAAEEEEGGSYGEEEEEPAIEDVQEETQLDLSGDSVKSIAKLWDSKM → MGQQDGE
         234-247: VAGGLTNLSKMPAC → EVPAGSLWQSLLIG
         248-499: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:195
    Mass (Da):21,800
    Checksum:i20F419708DFBDE89
    GO
    Isoform 5 (identifier: Q8CCF0-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         177-185: QQLSDEELE → GSPLQVNQD
         186-499: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:185
    Mass (Da):20,644
    Checksum:i95A88E010E2F42DA
    GO

    Sequence cautioni

    The sequence BAC25109.1 differs from that shown. Reason: Frameshift at position 357.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti77 – 771V → A in AAK77987. (PubMed:11867543)Curated
    Sequence conflicti77 – 771V → A in BAC31931. (PubMed:16141072)Curated
    Sequence conflicti77 – 771V → A in CAJ18397. 1 PublicationCurated
    Sequence conflicti77 – 771V → A in AAH18376. (PubMed:15489334)Curated
    Sequence conflicti77 – 771V → A in AAH57877. (PubMed:15489334)Curated
    Sequence conflicti104 – 1041E → V in BAC28192. (PubMed:16141072)Curated
    Sequence conflicti177 – 1771Q → R in BAC28220. (PubMed:16141072)Curated
    Sequence conflicti177 – 1771Q → R in BAC28192. (PubMed:16141072)Curated
    Sequence conflicti382 – 3821E → G in BAC25109. (PubMed:16141072)Curated
    Sequence conflicti481 – 4811S → F in AAH61461. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5959MSLAD…WDSKM → MGQQDGE in isoform 4. 1 PublicationVSP_017585Add
    BLAST
    Alternative sequencei1 – 66MSLADE → MS in isoform 3. 1 PublicationVSP_017586
    Alternative sequencei177 – 1859QQLSDEELE → GSPLQVNQD in isoform 5. 1 PublicationVSP_017587
    Alternative sequencei186 – 499314Missing in isoform 5. 1 PublicationVSP_017588Add
    BLAST
    Alternative sequencei234 – 24714VAGGL…KMPAC → EVPAGSLWQSLLIG in isoform 4. 1 PublicationVSP_017589Add
    BLAST
    Alternative sequencei248 – 499252Missing in isoform 4. 1 PublicationVSP_017590Add
    BLAST
    Alternative sequencei316 – 3216Missing in isoform 2. 1 PublicationVSP_017591

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY040823 mRNA. Translation: AAK77987.1.
    AK005294 mRNA. Translation: BAC25109.1. Frameshift.
    AK033190 mRNA. Translation: BAC28192.1.
    AK033283 mRNA. Translation: BAC28220.1.
    AK044398 mRNA. Translation: BAC31903.1.
    AK044457 mRNA. Translation: BAC31931.1.
    AK051260 mRNA. Translation: BAC34578.1.
    CT010189 mRNA. Translation: CAJ18397.1.
    AC130680 Genomic DNA. No translation available.
    BC018376 mRNA. Translation: AAH18376.1.
    BC057877 mRNA. Translation: AAH57877.1.
    BC061461 mRNA. Translation: AAH61461.1.
    CCDSiCCDS39729.1. [Q8CCF0-1]
    CCDS51965.1. [Q8CCF0-2]
    RefSeqiNP_001153186.1. NM_001159714.1. [Q8CCF0-2]
    NP_081604.3. NM_027328.4. [Q8CCF0-1]
    XP_006540409.1. XM_006540346.1. [Q8CCF0-1]
    UniGeneiMm.246863.

    Genome annotation databases

    EnsembliENSMUST00000008517; ENSMUSP00000008517; ENSMUSG00000008373. [Q8CCF0-1]
    ENSMUST00000108636; ENSMUSP00000104276; ENSMUSG00000008373. [Q8CCF0-2]
    ENSMUST00000179769; ENSMUSP00000136031; ENSMUSG00000008373. [Q8CCF0-2]
    GeneIDi68988.
    KEGGimmu:68988.
    UCSCiuc009evi.2. mouse. [Q8CCF0-1]
    uc012ewf.1. mouse. [Q8CCF0-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY040823 mRNA. Translation: AAK77987.1 .
    AK005294 mRNA. Translation: BAC25109.1 . Frameshift.
    AK033190 mRNA. Translation: BAC28192.1 .
    AK033283 mRNA. Translation: BAC28220.1 .
    AK044398 mRNA. Translation: BAC31903.1 .
    AK044457 mRNA. Translation: BAC31931.1 .
    AK051260 mRNA. Translation: BAC34578.1 .
    CT010189 mRNA. Translation: CAJ18397.1 .
    AC130680 Genomic DNA. No translation available.
    BC018376 mRNA. Translation: AAH18376.1 .
    BC057877 mRNA. Translation: AAH57877.1 .
    BC061461 mRNA. Translation: AAH61461.1 .
    CCDSi CCDS39729.1. [Q8CCF0-1 ]
    CCDS51965.1. [Q8CCF0-2 ]
    RefSeqi NP_001153186.1. NM_001159714.1. [Q8CCF0-2 ]
    NP_081604.3. NM_027328.4. [Q8CCF0-1 ]
    XP_006540409.1. XM_006540346.1. [Q8CCF0-1 ]
    UniGenei Mm.246863.

    3D structure databases

    ProteinModelPortali Q8CCF0.
    SMRi Q8CCF0. Positions 86-332.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 213160. 2 interactions.
    IntActi Q8CCF0. 1 interaction.
    MINTi MINT-4115085.

    PTM databases

    PhosphoSitei Q8CCF0.

    Proteomic databases

    MaxQBi Q8CCF0.
    PaxDbi Q8CCF0.
    PRIDEi Q8CCF0.

    Protocols and materials databases

    DNASUi 68988.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000008517 ; ENSMUSP00000008517 ; ENSMUSG00000008373 . [Q8CCF0-1 ]
    ENSMUST00000108636 ; ENSMUSP00000104276 ; ENSMUSG00000008373 . [Q8CCF0-2 ]
    ENSMUST00000179769 ; ENSMUSP00000136031 ; ENSMUSG00000008373 . [Q8CCF0-2 ]
    GeneIDi 68988.
    KEGGi mmu:68988.
    UCSCi uc009evi.2. mouse. [Q8CCF0-1 ]
    uc012ewf.1. mouse. [Q8CCF0-2 ]

    Organism-specific databases

    CTDi 26121.
    MGIi MGI:1916238. Prpf31.

    Phylogenomic databases

    eggNOGi COG1498.
    GeneTreei ENSGT00550000075069.
    HOVERGENi HBG082193.
    InParanoidi Q8CCF0.
    KOi K12844.
    OMAi RKHANRM.
    OrthoDBi EOG7RJPRF.
    TreeFami TF300677.

    Miscellaneous databases

    NextBioi 328355.
    PROi Q8CCF0.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q8CCF0.
    Genevestigatori Q8CCF0.

    Family and domain databases

    InterProi IPR002687. Nop_dom.
    IPR012976. NOSIC.
    IPR027105. Prp31.
    IPR019175. Prp31_C.
    [Graphical view ]
    PANTHERi PTHR13904. PTHR13904. 1 hit.
    Pfami PF01798. Nop. 1 hit.
    PF08060. NOSIC. 1 hit.
    PF09785. Prp31_C. 1 hit.
    [Graphical view ]
    SMARTi SM00931. NOSIC. 1 hit.
    [Graphical view ]
    PROSITEi PS51358. NOP. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Protein 61K, encoded by a gene (PRPF31) linked to autosomal dominant retinitis pigmentosa, is required for U4/U6.U5 tri-snRNP formation and pre-mRNA splicing."
      Makarova O.V., Makarov E.M., Liu S., Vornlocher H.-P., Luehrmann R.
      EMBO J. 21:1148-1157(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Strain: C57BL/6J X CBA/J.
      Tissue: Lung.
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 4 AND 5).
      Strain: C57BL/6J.
      Tissue: Cerebellum, Retina, Spinal ganglion and Testis.
    3. "Cloning of mouse full open reading frames in Gateway(R) system entry vector (pDONR201)."
      Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J., Wiemann S., Schick M., Korn B.
      Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Strain: FVB/N and NMRI.
      Tissue: Brain and Mammary tumor.
    6. "SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways."
      Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.
      Mol. Cell 50:919-930(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-438, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Embryonic fibroblast.

    Entry informationi

    Entry nameiPRP31_MOUSE
    AccessioniPrimary (citable) accession number: Q8CCF0
    Secondary accession number(s): E9QPM6
    , Q6P7X2, Q8BQ91, Q8C8U4, Q8C8V5, Q8CCG6, Q8CF52, Q8VBW3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 21, 2006
    Last sequence update: July 27, 2011
    Last modified: October 1, 2014
    This is version 98 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3