SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8CC27

- CACB2_MOUSE

UniProt

Q8CC27 - CACB2_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Voltage-dependent L-type calcium channel subunit beta-2

Gene
Cacnb2, Cacnlb2
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting By similarity.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei544 – 5441Required for CaMK2D-binding By similarity

GO - Molecular functioni

  1. high voltage-gated calcium channel activity Source: MGI
  2. protein binding Source: MGI

GO - Biological processi

  1. calcium ion import Source: Ensembl
  2. positive regulation of calcium ion transport Source: Ensembl
  3. synaptic transmission Source: MGI
  4. visual perception Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Calcium channel, Ion channel, Voltage-gated channel

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

Calcium

Enzyme and pathway databases

ReactomeiREACT_225645. Depolarization of the Presynaptic Terminal Triggers the Opening of Calcium Channels.

Names & Taxonomyi

Protein namesi
Recommended name:
Voltage-dependent L-type calcium channel subunit beta-2
Short name:
CAB2
Alternative name(s):
Calcium channel voltage-dependent subunit beta 2
Gene namesi
Name:Cacnb2
Synonyms:Cacnlb2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 2

Organism-specific databases

MGIiMGI:894644. Cacnb2.

Subcellular locationi

GO - Cellular componenti

  1. plasma membrane Source: Reactome
  2. sarcolemma Source: UniProtKB-SubCell
  3. voltage-gated calcium channel complex Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 655655Voltage-dependent L-type calcium channel subunit beta-2PRO_0000144052Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei549 – 5491Phosphothreonine; by CaMK2D By similarity

Post-translational modificationi

Regulated through phosphorylation at Thr-549 by CaMK2D By similarity.

Keywords - PTMi

Phosphoprotein

Proteomic databases

PRIDEiQ8CC27.

PTM databases

PhosphoSiteiQ8CC27.

Expressioni

Gene expression databases

ArrayExpressiQ8CC27.
BgeeiQ8CC27.
GenevestigatoriQ8CC27.

Interactioni

Subunit structurei

The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. Interacts with RRAD. Interaction with RRAD regulates the trafficking of CACNA1C to the cell membrane. Interacts with CAMK2D By similarity.

Protein-protein interaction databases

BioGridi198440. 2 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ8CC27.
SMRiQ8CC27. Positions 86-212, 268-467.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini110 – 17970SH3Add
BLAST

Sequence similaritiesi

Contains 1 SH3 domain.

Keywords - Domaini

SH3 domain

Phylogenomic databases

eggNOGiNOG326500.
GeneTreeiENSGT00390000002740.
HOGENOMiHOG000230979.
HOVERGENiHBG050765.
InParanoidiQ8CC27.
KOiK04863.
OMAiDSAYVEP.
OrthoDBiEOG7966G4.
PhylomeDBiQ8CC27.
TreeFamiTF316195.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR008145. GK/Ca_channel_bsu.
IPR027417. P-loop_NTPase.
IPR001452. SH3_domain.
IPR005444. VDCC_L_b2su.
IPR000584. VDCC_L_bsu.
[Graphical view]
PANTHERiPTHR11824. PTHR11824. 1 hit.
PfamiPF00625. Guanylate_kin. 1 hit.
PF12052. VGCC_beta4Aa_N. 1 hit.
[Graphical view]
PRINTSiPR01626. LCACHANNELB.
PR01628. LCACHANNELB2.
SMARTiSM00072. GuKc. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50002. SH3. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8CC27-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MVQSDTSKSP PVAAVAQESQ MELLESAAPA GALGAQSYGK GARRKNRFKG    50
SDGSTSSDTT SNSFVRQGSA DSYTSRPSDS DVSLEEDREA VRREAERQAQ 100
AQLEKAKTKP VAFAVRTNVR YSAAQEDDVP VPGMAISFEA KDFLHVKEKF 150
NNDWWIGRLV KEGCEIGFIP SPVKLENMRL QHEQRAKQGK FYSSKSGGNS 200
SSSLGDIVPS SRKSTPPSSA IDIDATGLDA EENDIPANHR SPKPSANSVT 250
SPHSKEKRMP FFKKTEHTPP YDVVPSMRPV VLVGPSLKGY EVTDMMQKAL 300
FDFLKHRFEG RISITRVTAD ISLAKRSVLN NPSKHAIIER SNTRSSLAEV 350
QSEIERIFEL ARTLQLVVLD ADTINHPAQL SKTSLAPIIV YVKISSPKVL 400
QRLIKSRGKS QAKHLNVQMV AADKLAQCPP QESFDVILDE NQLEDACEHL 450
ADYLEAYWKA THPPSGNLPN PLLSRTLASS TLPLSPTLAS NSQGSQGDQR 500
PDRSAPRSAS QAEEEPCLEP VKKSQHRSSS ATHQNHRSGT GRGLSRQETF 550
DSETQESRDS AYVEPKEDYS HEHVDRYVPH REHNHREETH SSNGHRHRES 600
RHRSRDMGRD QDHNECIKQR SRHKSKDRYC DKEGEVISKR RNEAGEWNRD 650
VYIRQ 655
Length:655
Mass (Da):73,149
Last modified:March 1, 2003 - v1
Checksum:i77841E9C2613843D
GO
Isoform 2 (identifier: Q8CC27-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MVQSDTSKSP...DTTSNSFVRQ → MQCCGLVHRRRVRVSY

Note: No experimental confirmation available.

Show »
Length:604
Mass (Da):68,177
Checksum:i39F9F23B13FD6A3C
GO
Isoform 3 (identifier: Q8CC27-3) [UniParc]FASTAAdd to Basket

Also known as: Beta-2g

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MVQSDTSKSP...DTTSNSFVRQ → MKATWIRLLKRAKGGRLKSSDIC

Show »
Length:611
Mass (Da):68,846
Checksum:i78A1F9C1F1EF5E8C
GO
Isoform 4 (identifier: Q8CC27-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MVQSDTSKSP...DTTSNSFVRQ → MKATWIRLLKRAKGGRLKSSDIC
     221-264: IDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → KQKQKS

Note: No experimental confirmation available.

Show »
Length:573
Mass (Da):64,714
Checksum:iA60ED93AFCAEF5B3
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6767MVQSD…SFVRQ → MQCCGLVHRRRVRVSY in isoform 2. VSP_010730Add
BLAST
Alternative sequencei1 – 6767MVQSD…SFVRQ → MKATWIRLLKRAKGGRLKSS DIC in isoform 3 and isoform 4. VSP_010731Add
BLAST
Alternative sequencei221 – 26444IDIDA…PFFKK → KQKQKS in isoform 4. VSP_010732Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti124 – 1241A → R in BAD01474. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB109465 Genomic DNA. Translation: BAD01474.1.
AK020806 mRNA. Translation: BAB32216.1.
AK034054 mRNA. Translation: BAC28562.1.
AK078220 mRNA. Translation: BAC37179.1.
AL928632 Genomic DNA. Translation: CAM20242.1.
CCDSiCCDS15702.1. [Q8CC27-1]
RefSeqiNP_075605.1. NM_023116.4. [Q8CC27-1]
XP_006497383.1. XM_006497320.1. [Q8CC27-2]
XP_006497385.1. XM_006497322.1. [Q8CC27-4]
UniGeneiMm.313930.

Genome annotation databases

EnsembliENSMUST00000114719; ENSMUSP00000110367; ENSMUSG00000057914. [Q8CC27-3]
ENSMUST00000114723; ENSMUSP00000110371; ENSMUSG00000057914. [Q8CC27-1]
GeneIDi12296.
KEGGimmu:12296.
UCSCiuc008ikm.2. mouse. [Q8CC27-1]
uc008iks.2. mouse. [Q8CC27-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB109465 Genomic DNA. Translation: BAD01474.1 .
AK020806 mRNA. Translation: BAB32216.1 .
AK034054 mRNA. Translation: BAC28562.1 .
AK078220 mRNA. Translation: BAC37179.1 .
AL928632 Genomic DNA. Translation: CAM20242.1 .
CCDSi CCDS15702.1. [Q8CC27-1 ]
RefSeqi NP_075605.1. NM_023116.4. [Q8CC27-1 ]
XP_006497383.1. XM_006497320.1. [Q8CC27-2 ]
XP_006497385.1. XM_006497322.1. [Q8CC27-4 ]
UniGenei Mm.313930.

3D structure databases

ProteinModelPortali Q8CC27.
SMRi Q8CC27. Positions 86-212, 268-467.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 198440. 2 interactions.

PTM databases

PhosphoSitei Q8CC27.

Proteomic databases

PRIDEi Q8CC27.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000114719 ; ENSMUSP00000110367 ; ENSMUSG00000057914 . [Q8CC27-3 ]
ENSMUST00000114723 ; ENSMUSP00000110371 ; ENSMUSG00000057914 . [Q8CC27-1 ]
GeneIDi 12296.
KEGGi mmu:12296.
UCSCi uc008ikm.2. mouse. [Q8CC27-1 ]
uc008iks.2. mouse. [Q8CC27-3 ]

Organism-specific databases

CTDi 783.
MGIi MGI:894644. Cacnb2.

Phylogenomic databases

eggNOGi NOG326500.
GeneTreei ENSGT00390000002740.
HOGENOMi HOG000230979.
HOVERGENi HBG050765.
InParanoidi Q8CC27.
KOi K04863.
OMAi DSAYVEP.
OrthoDBi EOG7966G4.
PhylomeDBi Q8CC27.
TreeFami TF316195.

Enzyme and pathway databases

Reactomei REACT_225645. Depolarization of the Presynaptic Terminal Triggers the Opening of Calcium Channels.

Miscellaneous databases

ChiTaRSi CACNB2. mouse.
NextBioi 280802.
PROi Q8CC27.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q8CC27.
Bgeei Q8CC27.
Genevestigatori Q8CC27.

Family and domain databases

Gene3Di 3.40.50.300. 1 hit.
InterProi IPR008145. GK/Ca_channel_bsu.
IPR027417. P-loop_NTPase.
IPR001452. SH3_domain.
IPR005444. VDCC_L_b2su.
IPR000584. VDCC_L_bsu.
[Graphical view ]
PANTHERi PTHR11824. PTHR11824. 1 hit.
Pfami PF00625. Guanylate_kin. 1 hit.
PF12052. VGCC_beta4Aa_N. 1 hit.
[Graphical view ]
PRINTSi PR01626. LCACHANNELB.
PR01628. LCACHANNELB2.
SMARTi SM00072. GuKc. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view ]
SUPFAMi SSF50044. SSF50044. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEi PS50002. SH3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Genetic characterization of a new splice variant of the beta2 subunit of the voltage-dependent calcium channel."
    Murakami M., Aoyama M., Suzuki T., Sasano H., Nakayama S., Iijima T.
    Mol. Cell. Biochem. 254:217-225(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 3), FUNCTION.
    Tissue: Heart.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4).
    Strain: C57BL/6J.
    Tissue: Diencephalon, Olfactory bulb and Retina.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.

Entry informationi

Entry nameiCACB2_MOUSE
AccessioniPrimary (citable) accession number: Q8CC27
Secondary accession number(s): A2ASJ8, Q8C5J5, Q9CTQ6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 5, 2004
Last sequence update: March 1, 2003
Last modified: September 3, 2014
This is version 102 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi