Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Voltage-dependent L-type calcium channel subunit beta-2

Gene

Cacnb2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.By similarity1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei544Required for CaMK2D-bindingBy similarity1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Calcium channel, Ion channel, Voltage-gated channel

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

Calcium

Enzyme and pathway databases

ReactomeiR-MMU-112308. Depolarization of the Presynaptic Terminal Triggers the Opening of Calcium Channels.
R-MMU-419037. NCAM1 interactions.
R-MMU-422356. Regulation of insulin secretion.
R-MMU-5576892. Phase 0 - rapid depolarisation.
R-MMU-5576893. Phase 2 - plateau phase.
R-MMU-5576894. Phase 1 - inactivation of fast Na+ channels.

Names & Taxonomyi

Protein namesi
Recommended name:
Voltage-dependent L-type calcium channel subunit beta-2
Short name:
CAB2
Alternative name(s):
Calcium channel voltage-dependent subunit beta 2
Gene namesi
Name:Cacnb2
Synonyms:Cacnlb2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:894644. Cacnb2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001440521 – 655Voltage-dependent L-type calcium channel subunit beta-2Add BLAST655

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei200PhosphoserineBy similarity1
Modified residuei203PhosphoserineCombined sources1
Modified residuei214PhosphoserineCombined sources1
Modified residuei545PhosphoserineCombined sources1
Modified residuei549PhosphothreonineCombined sources1

Post-translational modificationi

Regulated through phosphorylation at Thr-549 by CaMK2D.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8CC27.
PRIDEiQ8CC27.

PTM databases

iPTMnetiQ8CC27.
PhosphoSitePlusiQ8CC27.

Expressioni

Gene expression databases

BgeeiENSMUSG00000057914.
ExpressionAtlasiQ8CC27. baseline and differential.
GenevisibleiQ8CC27. MM.

Interactioni

Subunit structurei

The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. Interacts with RRAD. Interaction with RRAD regulates the trafficking of CACNA1C to the cell membrane. Interacts with CAMK2D (By similarity). Interacts with CBARP.By similarity1 Publication

GO - Molecular functioni

  • actin filament binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi198440. 2 interactors.
STRINGi10090.ENSMUSP00000110371.

Structurei

3D structure databases

ProteinModelPortaliQ8CC27.
SMRiQ8CC27.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini110 – 179SH3PROSITE-ProRule annotationAdd BLAST70

Sequence similaritiesi

Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

SH3 domain

Phylogenomic databases

eggNOGiKOG3812. Eukaryota.
ENOG410XRDI. LUCA.
GeneTreeiENSGT00390000002740.
HOGENOMiHOG000230979.
HOVERGENiHBG050765.
InParanoidiQ8CC27.
KOiK04863.
OMAiYCDKDGE.
OrthoDBiEOG091G09C1.
PhylomeDBiQ8CC27.
TreeFamiTF316195.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR008145. GK/Ca_channel_bsu.
IPR027417. P-loop_NTPase.
IPR001452. SH3_domain.
IPR005444. VDCC_L_b2su.
IPR000584. VDCC_L_bsu.
[Graphical view]
PANTHERiPTHR11824. PTHR11824. 1 hit.
PfamiPF00625. Guanylate_kin. 1 hit.
PF12052. VGCC_beta4Aa_N. 1 hit.
[Graphical view]
PRINTSiPR01626. LCACHANNELB.
PR01628. LCACHANNELB2.
SMARTiSM00072. GuKc. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50002. SH3. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8CC27-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVQSDTSKSP PVAAVAQESQ MELLESAAPA GALGAQSYGK GARRKNRFKG
60 70 80 90 100
SDGSTSSDTT SNSFVRQGSA DSYTSRPSDS DVSLEEDREA VRREAERQAQ
110 120 130 140 150
AQLEKAKTKP VAFAVRTNVR YSAAQEDDVP VPGMAISFEA KDFLHVKEKF
160 170 180 190 200
NNDWWIGRLV KEGCEIGFIP SPVKLENMRL QHEQRAKQGK FYSSKSGGNS
210 220 230 240 250
SSSLGDIVPS SRKSTPPSSA IDIDATGLDA EENDIPANHR SPKPSANSVT
260 270 280 290 300
SPHSKEKRMP FFKKTEHTPP YDVVPSMRPV VLVGPSLKGY EVTDMMQKAL
310 320 330 340 350
FDFLKHRFEG RISITRVTAD ISLAKRSVLN NPSKHAIIER SNTRSSLAEV
360 370 380 390 400
QSEIERIFEL ARTLQLVVLD ADTINHPAQL SKTSLAPIIV YVKISSPKVL
410 420 430 440 450
QRLIKSRGKS QAKHLNVQMV AADKLAQCPP QESFDVILDE NQLEDACEHL
460 470 480 490 500
ADYLEAYWKA THPPSGNLPN PLLSRTLASS TLPLSPTLAS NSQGSQGDQR
510 520 530 540 550
PDRSAPRSAS QAEEEPCLEP VKKSQHRSSS ATHQNHRSGT GRGLSRQETF
560 570 580 590 600
DSETQESRDS AYVEPKEDYS HEHVDRYVPH REHNHREETH SSNGHRHRES
610 620 630 640 650
RHRSRDMGRD QDHNECIKQR SRHKSKDRYC DKEGEVISKR RNEAGEWNRD

VYIRQ
Length:655
Mass (Da):73,149
Last modified:March 1, 2003 - v1
Checksum:i77841E9C2613843D
GO
Isoform 2 (identifier: Q8CC27-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MVQSDTSKSP...DTTSNSFVRQ → MQCCGLVHRRRVRVSY

Note: No experimental confirmation available.
Show »
Length:604
Mass (Da):68,177
Checksum:i39F9F23B13FD6A3C
GO
Isoform 3 (identifier: Q8CC27-3) [UniParc]FASTAAdd to basket
Also known as: Beta-2g

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MVQSDTSKSP...DTTSNSFVRQ → MKATWIRLLKRAKGGRLKSSDIC

Show »
Length:611
Mass (Da):68,846
Checksum:i78A1F9C1F1EF5E8C
GO
Isoform 4 (identifier: Q8CC27-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MVQSDTSKSP...DTTSNSFVRQ → MKATWIRLLKRAKGGRLKSSDIC
     221-264: IDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → KQKQKS

Note: No experimental confirmation available.
Show »
Length:573
Mass (Da):64,714
Checksum:iA60ED93AFCAEF5B3
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti124A → R in BAD01474 (PubMed:14674701).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0107301 – 67MVQSD…SFVRQ → MQCCGLVHRRRVRVSY in isoform 2. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_0107311 – 67MVQSD…SFVRQ → MKATWIRLLKRAKGGRLKSS DIC in isoform 3 and isoform 4. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_010732221 – 264IDIDA…PFFKK → KQKQKS in isoform 4. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB109465 Genomic DNA. Translation: BAD01474.1.
AK020806 mRNA. Translation: BAB32216.1.
AK034054 mRNA. Translation: BAC28562.1.
AK078220 mRNA. Translation: BAC37179.1.
AL928632 Genomic DNA. Translation: CAM20242.1.
CCDSiCCDS15702.1. [Q8CC27-1]
RefSeqiNP_001296448.1. NM_001309519.1. [Q8CC27-3]
NP_075605.1. NM_023116.4. [Q8CC27-1]
XP_006497383.1. XM_006497320.1. [Q8CC27-2]
UniGeneiMm.313930.

Genome annotation databases

EnsembliENSMUST00000114719; ENSMUSP00000110367; ENSMUSG00000057914. [Q8CC27-3]
ENSMUST00000114723; ENSMUSP00000110371; ENSMUSG00000057914. [Q8CC27-1]
GeneIDi12296.
KEGGimmu:12296.
UCSCiuc008ikm.2. mouse. [Q8CC27-1]
uc008iks.2. mouse. [Q8CC27-3]
uc056zla.1. mouse. [Q8CC27-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB109465 Genomic DNA. Translation: BAD01474.1.
AK020806 mRNA. Translation: BAB32216.1.
AK034054 mRNA. Translation: BAC28562.1.
AK078220 mRNA. Translation: BAC37179.1.
AL928632 Genomic DNA. Translation: CAM20242.1.
CCDSiCCDS15702.1. [Q8CC27-1]
RefSeqiNP_001296448.1. NM_001309519.1. [Q8CC27-3]
NP_075605.1. NM_023116.4. [Q8CC27-1]
XP_006497383.1. XM_006497320.1. [Q8CC27-2]
UniGeneiMm.313930.

3D structure databases

ProteinModelPortaliQ8CC27.
SMRiQ8CC27.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi198440. 2 interactors.
STRINGi10090.ENSMUSP00000110371.

PTM databases

iPTMnetiQ8CC27.
PhosphoSitePlusiQ8CC27.

Proteomic databases

PaxDbiQ8CC27.
PRIDEiQ8CC27.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000114719; ENSMUSP00000110367; ENSMUSG00000057914. [Q8CC27-3]
ENSMUST00000114723; ENSMUSP00000110371; ENSMUSG00000057914. [Q8CC27-1]
GeneIDi12296.
KEGGimmu:12296.
UCSCiuc008ikm.2. mouse. [Q8CC27-1]
uc008iks.2. mouse. [Q8CC27-3]
uc056zla.1. mouse. [Q8CC27-4]

Organism-specific databases

CTDi783.
MGIiMGI:894644. Cacnb2.

Phylogenomic databases

eggNOGiKOG3812. Eukaryota.
ENOG410XRDI. LUCA.
GeneTreeiENSGT00390000002740.
HOGENOMiHOG000230979.
HOVERGENiHBG050765.
InParanoidiQ8CC27.
KOiK04863.
OMAiYCDKDGE.
OrthoDBiEOG091G09C1.
PhylomeDBiQ8CC27.
TreeFamiTF316195.

Enzyme and pathway databases

ReactomeiR-MMU-112308. Depolarization of the Presynaptic Terminal Triggers the Opening of Calcium Channels.
R-MMU-419037. NCAM1 interactions.
R-MMU-422356. Regulation of insulin secretion.
R-MMU-5576892. Phase 0 - rapid depolarisation.
R-MMU-5576893. Phase 2 - plateau phase.
R-MMU-5576894. Phase 1 - inactivation of fast Na+ channels.

Miscellaneous databases

ChiTaRSiCacnb2. mouse.
PROiQ8CC27.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000057914.
ExpressionAtlasiQ8CC27. baseline and differential.
GenevisibleiQ8CC27. MM.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR008145. GK/Ca_channel_bsu.
IPR027417. P-loop_NTPase.
IPR001452. SH3_domain.
IPR005444. VDCC_L_b2su.
IPR000584. VDCC_L_bsu.
[Graphical view]
PANTHERiPTHR11824. PTHR11824. 1 hit.
PfamiPF00625. Guanylate_kin. 1 hit.
PF12052. VGCC_beta4Aa_N. 1 hit.
[Graphical view]
PRINTSiPR01626. LCACHANNELB.
PR01628. LCACHANNELB2.
SMARTiSM00072. GuKc. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCACB2_MOUSE
AccessioniPrimary (citable) accession number: Q8CC27
Secondary accession number(s): A2ASJ8, Q8C5J5, Q9CTQ6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 5, 2004
Last sequence update: March 1, 2003
Last modified: November 2, 2016
This is version 122 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.