Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Voltage-dependent L-type calcium channel subunit beta-2

Gene

Cacnb2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.By similarity1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei544Required for CaMK2D-bindingBy similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionCalcium channel, Ion channel, Voltage-gated channel
Biological processCalcium transport, Ion transport, Transport
LigandCalcium

Enzyme and pathway databases

ReactomeiR-MMU-112308 Presynaptic depolarization and calcium channel opening
R-MMU-422356 Regulation of insulin secretion
R-MMU-5576892 Phase 0 - rapid depolarisation
R-MMU-5576893 Phase 2 - plateau phase

Names & Taxonomyi

Protein namesi
Recommended name:
Voltage-dependent L-type calcium channel subunit beta-2
Short name:
CAB2
Alternative name(s):
Calcium channel voltage-dependent subunit beta 2
Gene namesi
Name:Cacnb2
Synonyms:Cacnlb2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:894644 Cacnb2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001440521 – 655Voltage-dependent L-type calcium channel subunit beta-2Add BLAST655

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei200PhosphoserineBy similarity1
Modified residuei203PhosphoserineCombined sources1
Modified residuei214PhosphoserineCombined sources1
Modified residuei545PhosphoserineCombined sources1
Modified residuei549PhosphothreonineCombined sources1

Post-translational modificationi

Regulated through phosphorylation at Thr-549 by CaMK2D.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8CC27
PRIDEiQ8CC27

PTM databases

iPTMnetiQ8CC27
PhosphoSitePlusiQ8CC27

Expressioni

Gene expression databases

BgeeiENSMUSG00000057914
ExpressionAtlasiQ8CC27 baseline and differential
GenevisibleiQ8CC27 MM

Interactioni

Subunit structurei

Component of a calcium channel complex consisting of a pore-forming alpha subunit (CACNA1S) and the ancillary subunits CACNB1 or CACNB2, CACNG1 and CACNA2D1. The channel complex contains alpha, beta, gamma and delta subunits in a 1:1:1:1 ratio, i.e. it contains either CACNB1 or CACNB2. Interacts with CACNA1C (By similarity). Interacts with RRAD. Interaction with RRAD regulates the trafficking of CACNA1C to the cell membrane. Interacts with TMIGD2 (By similarity). Interacts with CAMK2D (By similarity). Interacts with CBARP (PubMed:24751537).By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi198440, 4 interactors
ComplexPortaliCPX-3194 Cardiac muscle VGCC complex
IntActiQ8CC27, 2 interactors
STRINGi10090.ENSMUSP00000110371

Structurei

3D structure databases

ProteinModelPortaliQ8CC27
SMRiQ8CC27
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini110 – 179SH3PROSITE-ProRule annotationAdd BLAST70

Sequence similaritiesi

Keywords - Domaini

SH3 domain

Phylogenomic databases

eggNOGiKOG3812 Eukaryota
ENOG410XRDI LUCA
GeneTreeiENSGT00390000002740
HOGENOMiHOG000230979
HOVERGENiHBG050765
InParanoidiQ8CC27
KOiK04863
OMAiNRDVYIR
OrthoDBiEOG091G09C1
PhylomeDBiQ8CC27
TreeFamiTF316195

Family and domain databases

CDDicd12040 SH3_CACNB2, 1 hit
InterProiView protein in InterPro
IPR035605 CACNB2_SH3
IPR008145 GK/Ca_channel_bsu
IPR027417 P-loop_NTPase
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR005444 VDCC_L_b2su
IPR000584 VDCC_L_bsu
PANTHERiPTHR11824 PTHR11824, 1 hit
PfamiView protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF12052 VGCC_beta4Aa_N, 1 hit
PRINTSiPR01626 LCACHANNELB
PR01628 LCACHANNELB2
SMARTiView protein in SMART
SM00072 GuKc, 1 hit
SUPFAMiSSF50044 SSF50044, 2 hits
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50002 SH3, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8CC27-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVQSDTSKSP PVAAVAQESQ MELLESAAPA GALGAQSYGK GARRKNRFKG
60 70 80 90 100
SDGSTSSDTT SNSFVRQGSA DSYTSRPSDS DVSLEEDREA VRREAERQAQ
110 120 130 140 150
AQLEKAKTKP VAFAVRTNVR YSAAQEDDVP VPGMAISFEA KDFLHVKEKF
160 170 180 190 200
NNDWWIGRLV KEGCEIGFIP SPVKLENMRL QHEQRAKQGK FYSSKSGGNS
210 220 230 240 250
SSSLGDIVPS SRKSTPPSSA IDIDATGLDA EENDIPANHR SPKPSANSVT
260 270 280 290 300
SPHSKEKRMP FFKKTEHTPP YDVVPSMRPV VLVGPSLKGY EVTDMMQKAL
310 320 330 340 350
FDFLKHRFEG RISITRVTAD ISLAKRSVLN NPSKHAIIER SNTRSSLAEV
360 370 380 390 400
QSEIERIFEL ARTLQLVVLD ADTINHPAQL SKTSLAPIIV YVKISSPKVL
410 420 430 440 450
QRLIKSRGKS QAKHLNVQMV AADKLAQCPP QESFDVILDE NQLEDACEHL
460 470 480 490 500
ADYLEAYWKA THPPSGNLPN PLLSRTLASS TLPLSPTLAS NSQGSQGDQR
510 520 530 540 550
PDRSAPRSAS QAEEEPCLEP VKKSQHRSSS ATHQNHRSGT GRGLSRQETF
560 570 580 590 600
DSETQESRDS AYVEPKEDYS HEHVDRYVPH REHNHREETH SSNGHRHRES
610 620 630 640 650
RHRSRDMGRD QDHNECIKQR SRHKSKDRYC DKEGEVISKR RNEAGEWNRD

VYIRQ
Length:655
Mass (Da):73,149
Last modified:March 1, 2003 - v1
Checksum:i77841E9C2613843D
GO
Isoform 2 (identifier: Q8CC27-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MVQSDTSKSP...DTTSNSFVRQ → MQCCGLVHRRRVRVSY

Note: No experimental confirmation available.
Show »
Length:604
Mass (Da):68,177
Checksum:i39F9F23B13FD6A3C
GO
Isoform 3 (identifier: Q8CC27-3) [UniParc]FASTAAdd to basket
Also known as: Beta-2g

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MVQSDTSKSP...DTTSNSFVRQ → MKATWIRLLKRAKGGRLKSSDIC

Show »
Length:611
Mass (Da):68,846
Checksum:i78A1F9C1F1EF5E8C
GO
Isoform 4 (identifier: Q8CC27-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MVQSDTSKSP...DTTSNSFVRQ → MKATWIRLLKRAKGGRLKSSDIC
     221-264: IDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → KQKQKS

Note: No experimental confirmation available.
Show »
Length:573
Mass (Da):64,714
Checksum:iA60ED93AFCAEF5B3
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti124A → R in BAD01474 (PubMed:14674701).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0107301 – 67MVQSD…SFVRQ → MQCCGLVHRRRVRVSY in isoform 2. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_0107311 – 67MVQSD…SFVRQ → MKATWIRLLKRAKGGRLKSS DIC in isoform 3 and isoform 4. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_010732221 – 264IDIDA…PFFKK → KQKQKS in isoform 4. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB109465 Genomic DNA Translation: BAD01474.1
AK020806 mRNA Translation: BAB32216.1
AK034054 mRNA Translation: BAC28562.1
AK078220 mRNA Translation: BAC37179.1
AL928632 Genomic DNA Translation: CAM20242.1
CCDSiCCDS15702.1 [Q8CC27-1]
CCDS84473.1 [Q8CC27-3]
RefSeqiNP_001296448.1, NM_001309519.1 [Q8CC27-3]
NP_075605.1, NM_023116.4 [Q8CC27-1]
XP_006497383.1, XM_006497320.1 [Q8CC27-2]
UniGeneiMm.313930

Genome annotation databases

EnsembliENSMUST00000114719; ENSMUSP00000110367; ENSMUSG00000057914 [Q8CC27-3]
ENSMUST00000114723; ENSMUSP00000110371; ENSMUSG00000057914 [Q8CC27-1]
GeneIDi12296
KEGGimmu:12296
UCSCiuc008ikm.2 mouse [Q8CC27-1]
uc008iks.2 mouse [Q8CC27-3]
uc056zla.1 mouse [Q8CC27-4]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCACB2_MOUSE
AccessioniPrimary (citable) accession number: Q8CC27
Secondary accession number(s): A2ASJ8, Q8C5J5, Q9CTQ6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 5, 2004
Last sequence update: March 1, 2003
Last modified: June 20, 2018
This is version 135 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health