Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Voltage-dependent L-type calcium channel subunit beta-2

Gene

Cacnb2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei544 – 5441Required for CaMK2D-bindingBy similarity

GO - Molecular functioni

  • high voltage-gated calcium channel activity Source: MGI
  • voltage-gated calcium channel activity Source: MGI

GO - Biological processi

  • calcium ion import Source: MGI
  • neuromuscular junction development Source: GO_Central
  • positive regulation of calcium ion transport Source: MGI
  • regulation of voltage-gated calcium channel activity Source: GO_Central
  • synaptic transmission Source: MGI
  • visual perception Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Calcium channel, Ion channel, Voltage-gated channel

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

Calcium

Enzyme and pathway databases

ReactomeiREACT_301949. Depolarization of the Presynaptic Terminal Triggers the Opening of Calcium Channels.
REACT_306614. Regulation of insulin secretion.
REACT_319054. NCAM1 interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Voltage-dependent L-type calcium channel subunit beta-2
Short name:
CAB2
Alternative name(s):
Calcium channel voltage-dependent subunit beta 2
Gene namesi
Name:Cacnb2
Synonyms:Cacnlb2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:894644. Cacnb2.

Subcellular locationi

GO - Cellular componenti

  • plasma membrane Source: Reactome
  • sarcolemma Source: UniProtKB-SubCell
  • voltage-gated calcium channel complex Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 655655Voltage-dependent L-type calcium channel subunit beta-2PRO_0000144052Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei549 – 5491Phosphothreonine; by CaMK2DBy similarity

Post-translational modificationi

Regulated through phosphorylation at Thr-549 by CaMK2D.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8CC27.
PRIDEiQ8CC27.

PTM databases

PhosphoSiteiQ8CC27.

Expressioni

Gene expression databases

BgeeiQ8CC27.
ExpressionAtlasiQ8CC27. baseline and differential.
GenevisibleiQ8CC27. MM.

Interactioni

Subunit structurei

The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. Interacts with RRAD. Interaction with RRAD regulates the trafficking of CACNA1C to the cell membrane. Interacts with CAMK2D (By similarity).By similarity

Protein-protein interaction databases

BioGridi198440. 2 interactions.
STRINGi10090.ENSMUSP00000110371.

Structurei

3D structure databases

ProteinModelPortaliQ8CC27.
SMRiQ8CC27. Positions 86-212, 268-467.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini110 – 17970SH3PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

SH3 domain

Phylogenomic databases

eggNOGiNOG326500.
GeneTreeiENSGT00390000002740.
HOGENOMiHOG000230979.
HOVERGENiHBG050765.
InParanoidiQ8CC27.
KOiK04863.
OMAiSAPHHNH.
OrthoDBiEOG7966G4.
PhylomeDBiQ8CC27.
TreeFamiTF316195.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR008145. GK/Ca_channel_bsu.
IPR027417. P-loop_NTPase.
IPR001452. SH3_domain.
IPR005444. VDCC_L_b2su.
IPR000584. VDCC_L_bsu.
[Graphical view]
PANTHERiPTHR11824. PTHR11824. 1 hit.
PfamiPF00625. Guanylate_kin. 1 hit.
PF12052. VGCC_beta4Aa_N. 1 hit.
[Graphical view]
PRINTSiPR01626. LCACHANNELB.
PR01628. LCACHANNELB2.
SMARTiSM00072. GuKc. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50002. SH3. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8CC27-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVQSDTSKSP PVAAVAQESQ MELLESAAPA GALGAQSYGK GARRKNRFKG
60 70 80 90 100
SDGSTSSDTT SNSFVRQGSA DSYTSRPSDS DVSLEEDREA VRREAERQAQ
110 120 130 140 150
AQLEKAKTKP VAFAVRTNVR YSAAQEDDVP VPGMAISFEA KDFLHVKEKF
160 170 180 190 200
NNDWWIGRLV KEGCEIGFIP SPVKLENMRL QHEQRAKQGK FYSSKSGGNS
210 220 230 240 250
SSSLGDIVPS SRKSTPPSSA IDIDATGLDA EENDIPANHR SPKPSANSVT
260 270 280 290 300
SPHSKEKRMP FFKKTEHTPP YDVVPSMRPV VLVGPSLKGY EVTDMMQKAL
310 320 330 340 350
FDFLKHRFEG RISITRVTAD ISLAKRSVLN NPSKHAIIER SNTRSSLAEV
360 370 380 390 400
QSEIERIFEL ARTLQLVVLD ADTINHPAQL SKTSLAPIIV YVKISSPKVL
410 420 430 440 450
QRLIKSRGKS QAKHLNVQMV AADKLAQCPP QESFDVILDE NQLEDACEHL
460 470 480 490 500
ADYLEAYWKA THPPSGNLPN PLLSRTLASS TLPLSPTLAS NSQGSQGDQR
510 520 530 540 550
PDRSAPRSAS QAEEEPCLEP VKKSQHRSSS ATHQNHRSGT GRGLSRQETF
560 570 580 590 600
DSETQESRDS AYVEPKEDYS HEHVDRYVPH REHNHREETH SSNGHRHRES
610 620 630 640 650
RHRSRDMGRD QDHNECIKQR SRHKSKDRYC DKEGEVISKR RNEAGEWNRD

VYIRQ
Length:655
Mass (Da):73,149
Last modified:March 1, 2003 - v1
Checksum:i77841E9C2613843D
GO
Isoform 2 (identifier: Q8CC27-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MVQSDTSKSP...DTTSNSFVRQ → MQCCGLVHRRRVRVSY

Note: No experimental confirmation available.
Show »
Length:604
Mass (Da):68,177
Checksum:i39F9F23B13FD6A3C
GO
Isoform 3 (identifier: Q8CC27-3) [UniParc]FASTAAdd to basket

Also known as: Beta-2g

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MVQSDTSKSP...DTTSNSFVRQ → MKATWIRLLKRAKGGRLKSSDIC

Show »
Length:611
Mass (Da):68,846
Checksum:i78A1F9C1F1EF5E8C
GO
Isoform 4 (identifier: Q8CC27-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MVQSDTSKSP...DTTSNSFVRQ → MKATWIRLLKRAKGGRLKSSDIC
     221-264: IDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → KQKQKS

Note: No experimental confirmation available.
Show »
Length:573
Mass (Da):64,714
Checksum:iA60ED93AFCAEF5B3
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti124 – 1241A → R in BAD01474 (PubMed:14674701).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6767MVQSD…SFVRQ → MQCCGLVHRRRVRVSY in isoform 2. 1 PublicationVSP_010730Add
BLAST
Alternative sequencei1 – 6767MVQSD…SFVRQ → MKATWIRLLKRAKGGRLKSS DIC in isoform 3 and isoform 4. 1 PublicationVSP_010731Add
BLAST
Alternative sequencei221 – 26444IDIDA…PFFKK → KQKQKS in isoform 4. 1 PublicationVSP_010732Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB109465 Genomic DNA. Translation: BAD01474.1.
AK020806 mRNA. Translation: BAB32216.1.
AK034054 mRNA. Translation: BAC28562.1.
AK078220 mRNA. Translation: BAC37179.1.
AL928632 Genomic DNA. Translation: CAM20242.1.
CCDSiCCDS15702.1. [Q8CC27-1]
RefSeqiNP_075605.1. NM_023116.4. [Q8CC27-1]
XP_006497383.1. XM_006497320.1. [Q8CC27-2]
UniGeneiMm.313930.

Genome annotation databases

EnsembliENSMUST00000114719; ENSMUSP00000110367; ENSMUSG00000057914. [Q8CC27-3]
ENSMUST00000114723; ENSMUSP00000110371; ENSMUSG00000057914. [Q8CC27-1]
GeneIDi12296.
KEGGimmu:12296.
UCSCiuc008ikm.2. mouse. [Q8CC27-1]
uc008iks.2. mouse. [Q8CC27-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB109465 Genomic DNA. Translation: BAD01474.1.
AK020806 mRNA. Translation: BAB32216.1.
AK034054 mRNA. Translation: BAC28562.1.
AK078220 mRNA. Translation: BAC37179.1.
AL928632 Genomic DNA. Translation: CAM20242.1.
CCDSiCCDS15702.1. [Q8CC27-1]
RefSeqiNP_075605.1. NM_023116.4. [Q8CC27-1]
XP_006497383.1. XM_006497320.1. [Q8CC27-2]
UniGeneiMm.313930.

3D structure databases

ProteinModelPortaliQ8CC27.
SMRiQ8CC27. Positions 86-212, 268-467.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi198440. 2 interactions.
STRINGi10090.ENSMUSP00000110371.

PTM databases

PhosphoSiteiQ8CC27.

Proteomic databases

MaxQBiQ8CC27.
PRIDEiQ8CC27.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000114719; ENSMUSP00000110367; ENSMUSG00000057914. [Q8CC27-3]
ENSMUST00000114723; ENSMUSP00000110371; ENSMUSG00000057914. [Q8CC27-1]
GeneIDi12296.
KEGGimmu:12296.
UCSCiuc008ikm.2. mouse. [Q8CC27-1]
uc008iks.2. mouse. [Q8CC27-3]

Organism-specific databases

CTDi783.
MGIiMGI:894644. Cacnb2.

Phylogenomic databases

eggNOGiNOG326500.
GeneTreeiENSGT00390000002740.
HOGENOMiHOG000230979.
HOVERGENiHBG050765.
InParanoidiQ8CC27.
KOiK04863.
OMAiSAPHHNH.
OrthoDBiEOG7966G4.
PhylomeDBiQ8CC27.
TreeFamiTF316195.

Enzyme and pathway databases

ReactomeiREACT_301949. Depolarization of the Presynaptic Terminal Triggers the Opening of Calcium Channels.
REACT_306614. Regulation of insulin secretion.
REACT_319054. NCAM1 interactions.

Miscellaneous databases

ChiTaRSiCacnb2. mouse.
NextBioi280802.
PROiQ8CC27.
SOURCEiSearch...

Gene expression databases

BgeeiQ8CC27.
ExpressionAtlasiQ8CC27. baseline and differential.
GenevisibleiQ8CC27. MM.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR008145. GK/Ca_channel_bsu.
IPR027417. P-loop_NTPase.
IPR001452. SH3_domain.
IPR005444. VDCC_L_b2su.
IPR000584. VDCC_L_bsu.
[Graphical view]
PANTHERiPTHR11824. PTHR11824. 1 hit.
PfamiPF00625. Guanylate_kin. 1 hit.
PF12052. VGCC_beta4Aa_N. 1 hit.
[Graphical view]
PRINTSiPR01626. LCACHANNELB.
PR01628. LCACHANNELB2.
SMARTiSM00072. GuKc. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Genetic characterization of a new splice variant of the beta2 subunit of the voltage-dependent calcium channel."
    Murakami M., Aoyama M., Suzuki T., Sasano H., Nakayama S., Iijima T.
    Mol. Cell. Biochem. 254:217-225(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 3), FUNCTION.
    Tissue: Heart.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4).
    Strain: C57BL/6J.
    Tissue: Diencephalon, Olfactory bulb and Retina.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.

Entry informationi

Entry nameiCACB2_MOUSE
AccessioniPrimary (citable) accession number: Q8CC27
Secondary accession number(s): A2ASJ8, Q8C5J5, Q9CTQ6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 5, 2004
Last sequence update: March 1, 2003
Last modified: June 24, 2015
This is version 109 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.