Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8CC27

- CACB2_MOUSE

UniProt

Q8CC27 - CACB2_MOUSE

Protein

Voltage-dependent L-type calcium channel subunit beta-2

Gene

Cacnb2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 103 (01 Oct 2014)
      Sequence version 1 (01 Mar 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei544 – 5441Required for CaMK2D-bindingBy similarity

    GO - Molecular functioni

    1. high voltage-gated calcium channel activity Source: MGI
    2. protein binding Source: MGI

    GO - Biological processi

    1. calcium ion import Source: Ensembl
    2. positive regulation of calcium ion transport Source: Ensembl
    3. synaptic transmission Source: MGI
    4. visual perception Source: MGI

    Keywords - Molecular functioni

    Calcium channel, Ion channel, Voltage-gated channel

    Keywords - Biological processi

    Calcium transport, Ion transport, Transport

    Keywords - Ligandi

    Calcium

    Enzyme and pathway databases

    ReactomeiREACT_225645. Depolarization of the Presynaptic Terminal Triggers the Opening of Calcium Channels.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Voltage-dependent L-type calcium channel subunit beta-2
    Short name:
    CAB2
    Alternative name(s):
    Calcium channel voltage-dependent subunit beta 2
    Gene namesi
    Name:Cacnb2
    Synonyms:Cacnlb2
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 2

    Organism-specific databases

    MGIiMGI:894644. Cacnb2.

    Subcellular locationi

    Cell membranesarcolemma By similarity; Peripheral membrane protein By similarity; Cytoplasmic side By similarity

    GO - Cellular componenti

    1. plasma membrane Source: Reactome
    2. sarcolemma Source: UniProtKB-SubCell
    3. voltage-gated calcium channel complex Source: MGI

    Keywords - Cellular componenti

    Cell membrane, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 655655Voltage-dependent L-type calcium channel subunit beta-2PRO_0000144052Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei549 – 5491Phosphothreonine; by CaMK2DBy similarity

    Post-translational modificationi

    Regulated through phosphorylation at Thr-549 by CaMK2D.By similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PRIDEiQ8CC27.

    PTM databases

    PhosphoSiteiQ8CC27.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8CC27.
    BgeeiQ8CC27.
    GenevestigatoriQ8CC27.

    Interactioni

    Subunit structurei

    The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. Interacts with RRAD. Interaction with RRAD regulates the trafficking of CACNA1C to the cell membrane. Interacts with CAMK2D By similarity.By similarity

    Protein-protein interaction databases

    BioGridi198440. 2 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8CC27.
    SMRiQ8CC27. Positions 86-212, 268-467.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini110 – 17970SH3PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 SH3 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    SH3 domain

    Phylogenomic databases

    eggNOGiNOG326500.
    GeneTreeiENSGT00390000002740.
    HOGENOMiHOG000230979.
    HOVERGENiHBG050765.
    InParanoidiQ8CC27.
    KOiK04863.
    OMAiDSAYVEP.
    OrthoDBiEOG7966G4.
    PhylomeDBiQ8CC27.
    TreeFamiTF316195.

    Family and domain databases

    Gene3Di3.40.50.300. 1 hit.
    InterProiIPR008145. GK/Ca_channel_bsu.
    IPR027417. P-loop_NTPase.
    IPR001452. SH3_domain.
    IPR005444. VDCC_L_b2su.
    IPR000584. VDCC_L_bsu.
    [Graphical view]
    PANTHERiPTHR11824. PTHR11824. 1 hit.
    PfamiPF00625. Guanylate_kin. 1 hit.
    PF12052. VGCC_beta4Aa_N. 1 hit.
    [Graphical view]
    PRINTSiPR01626. LCACHANNELB.
    PR01628. LCACHANNELB2.
    SMARTiSM00072. GuKc. 1 hit.
    SM00326. SH3. 1 hit.
    [Graphical view]
    SUPFAMiSSF50044. SSF50044. 2 hits.
    SSF52540. SSF52540. 1 hit.
    PROSITEiPS50002. SH3. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8CC27-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVQSDTSKSP PVAAVAQESQ MELLESAAPA GALGAQSYGK GARRKNRFKG    50
    SDGSTSSDTT SNSFVRQGSA DSYTSRPSDS DVSLEEDREA VRREAERQAQ 100
    AQLEKAKTKP VAFAVRTNVR YSAAQEDDVP VPGMAISFEA KDFLHVKEKF 150
    NNDWWIGRLV KEGCEIGFIP SPVKLENMRL QHEQRAKQGK FYSSKSGGNS 200
    SSSLGDIVPS SRKSTPPSSA IDIDATGLDA EENDIPANHR SPKPSANSVT 250
    SPHSKEKRMP FFKKTEHTPP YDVVPSMRPV VLVGPSLKGY EVTDMMQKAL 300
    FDFLKHRFEG RISITRVTAD ISLAKRSVLN NPSKHAIIER SNTRSSLAEV 350
    QSEIERIFEL ARTLQLVVLD ADTINHPAQL SKTSLAPIIV YVKISSPKVL 400
    QRLIKSRGKS QAKHLNVQMV AADKLAQCPP QESFDVILDE NQLEDACEHL 450
    ADYLEAYWKA THPPSGNLPN PLLSRTLASS TLPLSPTLAS NSQGSQGDQR 500
    PDRSAPRSAS QAEEEPCLEP VKKSQHRSSS ATHQNHRSGT GRGLSRQETF 550
    DSETQESRDS AYVEPKEDYS HEHVDRYVPH REHNHREETH SSNGHRHRES 600
    RHRSRDMGRD QDHNECIKQR SRHKSKDRYC DKEGEVISKR RNEAGEWNRD 650
    VYIRQ 655
    Length:655
    Mass (Da):73,149
    Last modified:March 1, 2003 - v1
    Checksum:i77841E9C2613843D
    GO
    Isoform 2 (identifier: Q8CC27-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-67: MVQSDTSKSP...DTTSNSFVRQ → MQCCGLVHRRRVRVSY

    Note: No experimental confirmation available.

    Show »
    Length:604
    Mass (Da):68,177
    Checksum:i39F9F23B13FD6A3C
    GO
    Isoform 3 (identifier: Q8CC27-3) [UniParc]FASTAAdd to Basket

    Also known as: Beta-2g

    The sequence of this isoform differs from the canonical sequence as follows:
         1-67: MVQSDTSKSP...DTTSNSFVRQ → MKATWIRLLKRAKGGRLKSSDIC

    Show »
    Length:611
    Mass (Da):68,846
    Checksum:i78A1F9C1F1EF5E8C
    GO
    Isoform 4 (identifier: Q8CC27-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-67: MVQSDTSKSP...DTTSNSFVRQ → MKATWIRLLKRAKGGRLKSSDIC
         221-264: IDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → KQKQKS

    Note: No experimental confirmation available.

    Show »
    Length:573
    Mass (Da):64,714
    Checksum:iA60ED93AFCAEF5B3
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti124 – 1241A → R in BAD01474. (PubMed:14674701)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6767MVQSD…SFVRQ → MQCCGLVHRRRVRVSY in isoform 2. 1 PublicationVSP_010730Add
    BLAST
    Alternative sequencei1 – 6767MVQSD…SFVRQ → MKATWIRLLKRAKGGRLKSS DIC in isoform 3 and isoform 4. 1 PublicationVSP_010731Add
    BLAST
    Alternative sequencei221 – 26444IDIDA…PFFKK → KQKQKS in isoform 4. 1 PublicationVSP_010732Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB109465 Genomic DNA. Translation: BAD01474.1.
    AK020806 mRNA. Translation: BAB32216.1.
    AK034054 mRNA. Translation: BAC28562.1.
    AK078220 mRNA. Translation: BAC37179.1.
    AL928632 Genomic DNA. Translation: CAM20242.1.
    CCDSiCCDS15702.1. [Q8CC27-1]
    RefSeqiNP_075605.1. NM_023116.4. [Q8CC27-1]
    XP_006497383.1. XM_006497320.1. [Q8CC27-2]
    XP_006497385.1. XM_006497322.1. [Q8CC27-4]
    UniGeneiMm.313930.

    Genome annotation databases

    EnsembliENSMUST00000114719; ENSMUSP00000110367; ENSMUSG00000057914. [Q8CC27-3]
    ENSMUST00000114723; ENSMUSP00000110371; ENSMUSG00000057914. [Q8CC27-1]
    GeneIDi12296.
    KEGGimmu:12296.
    UCSCiuc008ikm.2. mouse. [Q8CC27-1]
    uc008iks.2. mouse. [Q8CC27-3]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB109465 Genomic DNA. Translation: BAD01474.1 .
    AK020806 mRNA. Translation: BAB32216.1 .
    AK034054 mRNA. Translation: BAC28562.1 .
    AK078220 mRNA. Translation: BAC37179.1 .
    AL928632 Genomic DNA. Translation: CAM20242.1 .
    CCDSi CCDS15702.1. [Q8CC27-1 ]
    RefSeqi NP_075605.1. NM_023116.4. [Q8CC27-1 ]
    XP_006497383.1. XM_006497320.1. [Q8CC27-2 ]
    XP_006497385.1. XM_006497322.1. [Q8CC27-4 ]
    UniGenei Mm.313930.

    3D structure databases

    ProteinModelPortali Q8CC27.
    SMRi Q8CC27. Positions 86-212, 268-467.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 198440. 2 interactions.

    PTM databases

    PhosphoSitei Q8CC27.

    Proteomic databases

    PRIDEi Q8CC27.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000114719 ; ENSMUSP00000110367 ; ENSMUSG00000057914 . [Q8CC27-3 ]
    ENSMUST00000114723 ; ENSMUSP00000110371 ; ENSMUSG00000057914 . [Q8CC27-1 ]
    GeneIDi 12296.
    KEGGi mmu:12296.
    UCSCi uc008ikm.2. mouse. [Q8CC27-1 ]
    uc008iks.2. mouse. [Q8CC27-3 ]

    Organism-specific databases

    CTDi 783.
    MGIi MGI:894644. Cacnb2.

    Phylogenomic databases

    eggNOGi NOG326500.
    GeneTreei ENSGT00390000002740.
    HOGENOMi HOG000230979.
    HOVERGENi HBG050765.
    InParanoidi Q8CC27.
    KOi K04863.
    OMAi DSAYVEP.
    OrthoDBi EOG7966G4.
    PhylomeDBi Q8CC27.
    TreeFami TF316195.

    Enzyme and pathway databases

    Reactomei REACT_225645. Depolarization of the Presynaptic Terminal Triggers the Opening of Calcium Channels.

    Miscellaneous databases

    ChiTaRSi CACNB2. mouse.
    NextBioi 280802.
    PROi Q8CC27.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8CC27.
    Bgeei Q8CC27.
    Genevestigatori Q8CC27.

    Family and domain databases

    Gene3Di 3.40.50.300. 1 hit.
    InterProi IPR008145. GK/Ca_channel_bsu.
    IPR027417. P-loop_NTPase.
    IPR001452. SH3_domain.
    IPR005444. VDCC_L_b2su.
    IPR000584. VDCC_L_bsu.
    [Graphical view ]
    PANTHERi PTHR11824. PTHR11824. 1 hit.
    Pfami PF00625. Guanylate_kin. 1 hit.
    PF12052. VGCC_beta4Aa_N. 1 hit.
    [Graphical view ]
    PRINTSi PR01626. LCACHANNELB.
    PR01628. LCACHANNELB2.
    SMARTi SM00072. GuKc. 1 hit.
    SM00326. SH3. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50044. SSF50044. 2 hits.
    SSF52540. SSF52540. 1 hit.
    PROSITEi PS50002. SH3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Genetic characterization of a new splice variant of the beta2 subunit of the voltage-dependent calcium channel."
      Murakami M., Aoyama M., Suzuki T., Sasano H., Nakayama S., Iijima T.
      Mol. Cell. Biochem. 254:217-225(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 3), FUNCTION.
      Tissue: Heart.
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4).
      Strain: C57BL/6J.
      Tissue: Diencephalon, Olfactory bulb and Retina.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.

    Entry informationi

    Entry nameiCACB2_MOUSE
    AccessioniPrimary (citable) accession number: Q8CC27
    Secondary accession number(s): A2ASJ8, Q8C5J5, Q9CTQ6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 5, 2004
    Last sequence update: March 1, 2003
    Last modified: October 1, 2014
    This is version 103 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3