Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8CC27 (CACB2_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 98. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Voltage-dependent L-type calcium channel subunit beta-2

Short name=CAB2
Alternative name(s):
Calcium channel voltage-dependent subunit beta 2
Gene names
Name:Cacnb2
Synonyms:Cacnlb2
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length655 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting By similarity. Ref.1

Subunit structure

The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. Interacts with RRAD. Interaction with RRAD regulates the trafficking of CACNA1C to the cell membrane. Interacts with CAMK2D By similarity.

Subcellular location

Cell membranesarcolemma; Peripheral membrane protein; Cytoplasmic side By similarity.

Post-translational modification

Regulated through phosphorylation at Thr-549 by CaMK2D By similarity.

Sequence similarities

Belongs to the calcium channel beta subunit family.

Contains 1 SH3 domain.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8CC27-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8CC27-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MVQSDTSKSP...DTTSNSFVRQ → MQCCGLVHRRRVRVSY
Note: No experimental confirmation available.
Isoform 3 (identifier: Q8CC27-3)

Also known as: Beta-2g;

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MVQSDTSKSP...DTTSNSFVRQ → MKATWIRLLKRAKGGRLKSSDIC
Isoform 4 (identifier: Q8CC27-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MVQSDTSKSP...DTTSNSFVRQ → MKATWIRLLKRAKGGRLKSSDIC
     221-264: IDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → KQKQKS
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 655655Voltage-dependent L-type calcium channel subunit beta-2
PRO_0000144052

Regions

Domain110 – 17970SH3

Sites

Site5441Required for CaMK2D-binding By similarity

Amino acid modifications

Modified residue5491Phosphothreonine; by CaMK2D By similarity

Natural variations

Alternative sequence1 – 6767MVQSD…SFVRQ → MQCCGLVHRRRVRVSY in isoform 2.
VSP_010730
Alternative sequence1 – 6767MVQSD…SFVRQ → MKATWIRLLKRAKGGRLKSS DIC in isoform 3 and isoform 4.
VSP_010731
Alternative sequence221 – 26444IDIDA…PFFKK → KQKQKS in isoform 4.
VSP_010732

Experimental info

Sequence conflict1241A → R in BAD01474. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 1, 2003. Version 1.
Checksum: 77841E9C2613843D

FASTA65573,149
        10         20         30         40         50         60 
MVQSDTSKSP PVAAVAQESQ MELLESAAPA GALGAQSYGK GARRKNRFKG SDGSTSSDTT 

        70         80         90        100        110        120 
SNSFVRQGSA DSYTSRPSDS DVSLEEDREA VRREAERQAQ AQLEKAKTKP VAFAVRTNVR 

       130        140        150        160        170        180 
YSAAQEDDVP VPGMAISFEA KDFLHVKEKF NNDWWIGRLV KEGCEIGFIP SPVKLENMRL 

       190        200        210        220        230        240 
QHEQRAKQGK FYSSKSGGNS SSSLGDIVPS SRKSTPPSSA IDIDATGLDA EENDIPANHR 

       250        260        270        280        290        300 
SPKPSANSVT SPHSKEKRMP FFKKTEHTPP YDVVPSMRPV VLVGPSLKGY EVTDMMQKAL 

       310        320        330        340        350        360 
FDFLKHRFEG RISITRVTAD ISLAKRSVLN NPSKHAIIER SNTRSSLAEV QSEIERIFEL 

       370        380        390        400        410        420 
ARTLQLVVLD ADTINHPAQL SKTSLAPIIV YVKISSPKVL QRLIKSRGKS QAKHLNVQMV 

       430        440        450        460        470        480 
AADKLAQCPP QESFDVILDE NQLEDACEHL ADYLEAYWKA THPPSGNLPN PLLSRTLASS 

       490        500        510        520        530        540 
TLPLSPTLAS NSQGSQGDQR PDRSAPRSAS QAEEEPCLEP VKKSQHRSSS ATHQNHRSGT 

       550        560        570        580        590        600 
GRGLSRQETF DSETQESRDS AYVEPKEDYS HEHVDRYVPH REHNHREETH SSNGHRHRES 

       610        620        630        640        650 
RHRSRDMGRD QDHNECIKQR SRHKSKDRYC DKEGEVISKR RNEAGEWNRD VYIRQ 

« Hide

Isoform 2 [UniParc].

Checksum: 39F9F23B13FD6A3C
Show »

FASTA60468,177
Isoform 3 (Beta-2g) [UniParc].

Checksum: 78A1F9C1F1EF5E8C
Show »

FASTA61168,846
Isoform 4 [UniParc].

Checksum: A60ED93AFCAEF5B3
Show »

FASTA57364,714

References

« Hide 'large scale' references
[1]"Genetic characterization of a new splice variant of the beta2 subunit of the voltage-dependent calcium channel."
Murakami M., Aoyama M., Suzuki T., Sasano H., Nakayama S., Iijima T.
Mol. Cell. Biochem. 254:217-225(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 3), FUNCTION.
Tissue: Heart.
[2]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4).
Strain: C57BL/6J.
Tissue: Diencephalon, Olfactory bulb and Retina.
[3]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB109465 Genomic DNA. Translation: BAD01474.1.
AK020806 mRNA. Translation: BAB32216.1.
AK034054 mRNA. Translation: BAC28562.1.
AK078220 mRNA. Translation: BAC37179.1.
AL928632 Genomic DNA. Translation: CAM20242.1.
RefSeqNP_075605.1. NM_023116.4.
XP_006497383.1. XM_006497320.1.
XP_006497385.1. XM_006497322.1.
UniGeneMm.313930.

3D structure databases

ProteinModelPortalQ8CC27.
SMRQ8CC27. Positions 84-467.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid198440. 2 interactions.

PTM databases

PhosphoSiteQ8CC27.

Proteomic databases

PRIDEQ8CC27.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000114719; ENSMUSP00000110367; ENSMUSG00000057914. [Q8CC27-3]
ENSMUST00000114723; ENSMUSP00000110371; ENSMUSG00000057914. [Q8CC27-1]
GeneID12296.
KEGGmmu:12296.
UCSCuc008ikm.2. mouse. [Q8CC27-1]
uc008iks.2. mouse. [Q8CC27-3]

Organism-specific databases

CTD783.
MGIMGI:894644. Cacnb2.

Phylogenomic databases

eggNOGNOG326500.
GeneTreeENSGT00390000002740.
HOGENOMHOG000230979.
HOVERGENHBG050765.
InParanoidQ8CC27.
KOK04863.
OMADSAYVEP.
OrthoDBEOG7966G4.
PhylomeDBQ8CC27.
TreeFamTF316195.

Enzyme and pathway databases

ReactomeREACT_188576. Developmental Biology.

Gene expression databases

ArrayExpressQ8CC27.
BgeeQ8CC27.
GenevestigatorQ8CC27.

Family and domain databases

Gene3D3.40.50.300. 1 hit.
InterProIPR008145. GK/Ca_channel_bsu.
IPR027417. P-loop_NTPase.
IPR001452. SH3_domain.
IPR005444. VDCC_L_b2su.
IPR000584. VDCC_L_bsu.
[Graphical view]
PANTHERPTHR11824. PTHR11824. 1 hit.
PfamPF00625. Guanylate_kin. 1 hit.
PF12052. VGCC_beta4Aa_N. 1 hit.
[Graphical view]
PRINTSPR01626. LCACHANNELB.
PR01628. LCACHANNELB2.
SMARTSM00072. GuKc. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMSSF50044. SSF50044. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEPS50002. SH3. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSCACNB2. mouse.
NextBio280802.
PROQ8CC27.
SOURCESearch...

Entry information

Entry nameCACB2_MOUSE
AccessionPrimary (citable) accession number: Q8CC27
Secondary accession number(s): A2ASJ8, Q8C5J5, Q9CTQ6
Entry history
Integrated into UniProtKB/Swiss-Prot: July 5, 2004
Last sequence update: March 1, 2003
Last modified: April 16, 2014
This is version 98 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot