Reviewed,
UniProtKB/Swiss-Prot Q8CBQ5 (P4K2B_MOUSE)
Last modified
November 3, 2009.
Version 52.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Phosphatidylinositol 4-kinase type 2-beta EC=2.7.1.67 Alternative name(s): Phosphatidylinositol 4-kinase type II-beta | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 469 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Together with PI4K2A and the type III PI4Ks (PIK4CA and PIK4CB) it contributes to the overall PI4-kinase activity of the cell. This contribution may be especially significant in plasma membrane, endosomal and Golgi compartments. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). Contributes to the production of InsP3 in stimulated cells and is likely to be involved in the regulation of vesicular trafficking By similarity. |
| Catalytic activity | ATP + 1-phosphatidyl-1D-myo-inositol = ADP + 1-phosphatidyl-1D-myo-inositol 4-phosphate. |
| Enzyme regulation | Recruited and activated by membrane association. Binding to the microsomal membrane has been shown to enhance its activity By similarity. |
| Subcellular location | Cytoplasm By similarity. Membrane By similarity. Note: Mostly cytoplasmic but also found associated with the plasma membrane, the Golgi and endosomes. Compared to PI4K2A, a larger fraction of PI4K2B is cytosolic due to a smaller extent of palmitoylation. Translocates to membranes where it is recruited by PDGF stimulation by a Rac-GTP-dependent mechanism By similarity. |
| Sequence similarities | Belongs to the PI3/PI4-kinase family. Type II PI4K subfamily. Contains 1 PI3K/PI4K domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Membrane |
| Coding sequence diversity | Alternative splicing |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Transferase |
| Gene Ontology (GO) | |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | 1-phosphatidylinositol 4-kinase activity Inferred from electronic annotation. Source: EC ATP bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8CBQ5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8CBQ5-2) The sequence of this isoform differs from the canonical sequence as follows: 84-129: ETNTFLEDPEFADIVLKAEQAIEIGVFPERISQGSSGSYFVKDSKR → GPELCPFYSRSLCYKTTTALGYY | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 469 | 469 | Phosphatidylinositol 4-kinase type 2-beta | PRO_0000285165 | |||||
Regions | |||||||||
| Domain | 117 – 424 | 308 | PI3K/PI4K | ||||||
Natural variations | |||||||||
| Alternative sequence | 84 – 129 | 46 | ETNTF…KDSKR → GPELCPFYSRSLCYKTTTAL GYY in isoform 2. | VSP_024828 | |||||
Experimental info | |||||||||
| Sequence conflict | 199 | 1 | W → L in AAL04155. Ref.1 | ||||||
| Sequence conflict | 199 | 1 | W → L in BAB27819. Ref.3 | ||||||
| Sequence conflict | 229 – 236 | 8 | GRKFHRIG → AESPSDR in AAN37399. Ref.2 | ||||||
| Sequence conflict | 244 | 1 | F → S in AAN37399. Ref.2 | ||||||
| Sequence conflict | 244 | 1 | F → S in BAB30411. Ref.3 | ||||||
| Sequence conflict | 261 | 1 | F → Y in AAN37399. Ref.2 | ||||||
| Sequence conflict | 261 | 1 | F → Y in BAB30411. Ref.3 | ||||||
| Sequence conflict | 399 | 1 | R → K in AAH10257. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Beta isoform of mouse type II phosphatidylinositol 4-kinase (PI4KIIbeta)." Hong W. Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Strain: C57BL/6J. |
| [2] | "A gene from our subtracted mouse compacted embryo cDNA library." Li W., Lu G. Submitted (SEP-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Strain: Kunmingbai. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Strain: C57BL/6J and NOD. Tissue: Testis and Urinary bladder. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: FVB/N. Tissue: Embryo and Mammary tumor. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF411321 mRNA. Translation: AAL04155.1. AY148879 mRNA. Translation: AAN37399.1. AK011751 mRNA. Translation: BAB27819.1. AK016754 mRNA. Translation: BAB30411.1. AK035523 mRNA. Translation: BAC29091.1. AK170730 mRNA. Translation: BAE41986.1. BC010257 mRNA. Translation: AAH10257.1. BC062144 mRNA. Translation: AAH62144.1. | |
| IPI | IPI00136722. IPI00317443. |
| RefSeq | NP_080227.2. NP_083020.2. |
| UniGene | Mm.248647 |
3D structure databases | |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q8CBQ5. |
Proteomic databases | |
| PRIDE | Q8CBQ5. |
Genome annotation databases | |
| Ensembl | ENSMUST00000031081; ENSMUSP00000031081; ENSMUSG00000029186; Mus musculus. [Genome view] ENSMUST00000031082; ENSMUSP00000031082; ENSMUSG00000029186; Mus musculus. [Genome view] |
| GeneID | 67073. |
| KEGG | mmu:67073. |
| UCSC | uc008xkq.1. mouse. uc008xkr.1. mouse. |
Organism-specific databases | |
| CTD | 67073. |
| MGI | MGI:1914323. Pi4k2b. |
Phylogenomic databases | |
| HOVERGEN | Q8CBQ5. |
| OMA | AEQAIEF. |
Enzyme and pathway databases | |
| BRENDA | 2.7.1.67. 244. |
Gene expression databases | |
| ArrayExpress | Q8CBQ5. |
| Bgee | Q8CBQ5. |
| CleanEx | MM_PI4K2B. |
| Genevestigator | Q8CBQ5. |
Family and domain databases | |
| InterPro | IPR000403. PI3/4_kinase_cat. IPR018936. PI3/4_kinase_CS. [Graphical view] |
| Pfam | PF00454. PI3_PI4_kinase. 1 hit. [Graphical view] |
| PROSITE | PS00915. PI3_4_KINASE_1. False negative. PS00916. PI3_4_KINASE_2. False negative. PS50290. PI3_4_KINASE_3. False negative. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 323492. |
| SOURCE | Search... |
Entry information
| Entry name | P4K2B_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8CBQ5 Secondary accession number(s): Q91Z30, Q9D072, Q9D471 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


