Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Phosphatidylinositol 4-kinase type 2-beta

Gene

Pi4k2b

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Together with PI4K2A and the type III PI4Ks (PIK4CA and PIK4CB) it contributes to the overall PI4-kinase activity of the cell. This contribution may be especially significant in plasma membrane, endosomal and Golgi compartments. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). Contributes to the production of InsP3 in stimulated cells and is likely to be involved in the regulation of vesicular trafficking (By similarity).By similarity

Catalytic activityi

ATP + 1-phosphatidyl-1D-myo-inositol = ADP + 1-phosphatidyl-1D-myo-inositol 4-phosphate.

Enzyme regulationi

Recruited and activated by membrane association. Binding to the microsomal membrane has been shown to enhance its activity (By similarity).By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei136 – 1361ATPBy similarity
Binding sitei332 – 3321ATPBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi115 – 1217ATPBy similarity
Nucleotide bindingi245 – 2484ATPBy similarity

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

Kinase, Transferase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-MMU-1483248. Synthesis of PIPs at the ER membrane.
R-MMU-1660499. Synthesis of PIPs at the plasma membrane.
R-MMU-1660514. Synthesis of PIPs at the Golgi membrane.
R-MMU-1660516. Synthesis of PIPs at the early endosome membrane.

Names & Taxonomyi

Protein namesi
Recommended name:
Phosphatidylinositol 4-kinase type 2-beta (EC:2.7.1.67)
Alternative name(s):
Phosphatidylinositol 4-kinase type II-beta
Gene namesi
Name:Pi4k2b
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:1914323. Pi4k2b.

Subcellular locationi

  • Cytoplasm By similarity
  • Membrane By similarity

  • Note: Mostly cytoplasmic but also found associated with the plasma membrane, the Golgi and endosomes. Compared to PI4K2A, a larger fraction of PI4K2B is cytosolic due to a smaller extent of palmitoylation. Translocates to membranes where it is recruited by PDGF stimulation by a Rac-GTP-dependent mechanism (By similarity).By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 469469Phosphatidylinositol 4-kinase type 2-betaPRO_0000285165Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei37 – 371PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8CBQ5.
MaxQBiQ8CBQ5.
PaxDbiQ8CBQ5.
PRIDEiQ8CBQ5.

PTM databases

iPTMnetiQ8CBQ5.
PhosphoSiteiQ8CBQ5.
SwissPalmiQ8CBQ5.

Expressioni

Gene expression databases

BgeeiQ8CBQ5.
CleanExiMM_PI4K2B.
ExpressionAtlasiQ8CBQ5. baseline and differential.
GenevisibleiQ8CBQ5. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000031081.

Structurei

3D structure databases

ProteinModelPortaliQ8CBQ5.
SMRiQ8CBQ5. Positions 84-438.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini117 – 424308PI3K/PI4KAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni141 – 1433Important for substrate bindingBy similarity
Regioni149 – 16214Important for interaction with membranesBy similarityAdd
BLAST
Regioni252 – 2609Important for interaction with membranesBy similarity
Regioni345 – 35410Important for interaction with membranesBy similarity

Sequence similaritiesi

Contains 1 PI3K/PI4K domain.Curated

Phylogenomic databases

eggNOGiKOG2381. Eukaryota.
ENOG410XP06. LUCA.
GeneTreeiENSGT00390000010434.
HOGENOMiHOG000294076.
HOVERGENiHBG059542.
InParanoidiQ8CBQ5.
KOiK13711.
OMAiCEDLHEL.
OrthoDBiEOG7MKW5Z.
PhylomeDBiQ8CBQ5.
TreeFamiTF314740.

Family and domain databases

InterProiIPR000403. PI3/4_kinase_cat_dom.
[Graphical view]
PfamiPF00454. PI3_PI4_kinase. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8CBQ5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEACEPTRP SEDEDEEREP LLPRVAWAQP RRVAPGSAVR MQADEGADVL
60 70 80 90 100
REPATDEPPA VSGEGSISAS LSTELDRTRT TSSETNTFLE DPEFADIVLK
110 120 130 140 150
AEQAIEIGVF PERISQGSSG SYFVKDSKRN IIGVFKPKSE EPYGQLNPKW
160 170 180 190 200
TKYVHKVCCP CCFGRGCLLP NQGYLSEAGA YLVDVKLNLG IVPKTKVVWL
210 220 230 240 250
VSETFNYSAI DRAKSRGKKY ALEKVPKVGR KFHRIGLPPK VGSFQLFVKD
260 270 280 290 300
YKEAEYWLRR FEAEPLPENI RKQFQSQFEK LVILDYIIRN TDRGNDNWLV
310 320 330 340 350
KYDEMKYAKK IESEESNWID NKQLLIKIAA IDNGLAFPFK HPDEWRAYPF
360 370 380 390 400
HWAWLPQAKV PFSEETRNLI LPYISDMNFV QDLCEDLYEL FKTDKGFDRA
410 420 430 440 450
AFENQMSVMR GQILNLTQAL RDGKSPMQLA QMPCVIVECS KSGSQGRVVH
460
LGSSFTQTVH CRKPFFSSW
Length:469
Mass (Da):53,478
Last modified:March 1, 2003 - v1
Checksum:iB5CE80948E5B8954
GO
Isoform 2 (identifier: Q8CBQ5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     84-129: ETNTFLEDPEFADIVLKAEQAIEIGVFPERISQGSSGSYFVKDSKR → GPELCPFYSRSLCYKTTTALGYY

Show »
Length:446
Mass (Da):50,962
Checksum:iD32EB3277F0B160F
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti199 – 1991W → L in AAL04155 (Ref. 1) Curated
Sequence conflicti199 – 1991W → L in BAB27819 (PubMed:16141072).Curated
Sequence conflicti229 – 2368GRKFHRIG → AESPSDR in AAN37399 (Ref. 2) Curated
Sequence conflicti244 – 2441F → S in AAN37399 (Ref. 2) Curated
Sequence conflicti244 – 2441F → S in BAB30411 (PubMed:16141072).Curated
Sequence conflicti261 – 2611F → Y in AAN37399 (Ref. 2) Curated
Sequence conflicti261 – 2611F → Y in BAB30411 (PubMed:16141072).Curated
Sequence conflicti399 – 3991R → K in AAH10257 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei84 – 12946ETNTF…KDSKR → GPELCPFYSRSLCYKTTTAL GYY in isoform 2. 2 PublicationsVSP_024828Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF411321 mRNA. Translation: AAL04155.1.
AY148879 mRNA. Translation: AAN37399.1.
AK011751 mRNA. Translation: BAB27819.1.
AK016754 mRNA. Translation: BAB30411.1.
AK035523 mRNA. Translation: BAC29091.1.
AK170730 mRNA. Translation: BAE41986.1.
BC010257 mRNA. Translation: AAH10257.1.
BC062144 mRNA. Translation: AAH62144.1.
CCDSiCCDS19287.1. [Q8CBQ5-1]
CCDS39086.1. [Q8CBQ5-2]
RefSeqiNP_080227.2. NM_025951.3. [Q8CBQ5-1]
NP_083020.2. NM_028744.3. [Q8CBQ5-2]
UniGeneiMm.248647.

Genome annotation databases

EnsembliENSMUST00000031081; ENSMUSP00000031081; ENSMUSG00000029186. [Q8CBQ5-1]
ENSMUST00000031082; ENSMUSP00000031082; ENSMUSG00000029186. [Q8CBQ5-2]
GeneIDi67073.
KEGGimmu:67073.
UCSCiuc008xkq.2. mouse. [Q8CBQ5-1]
uc008xkr.2. mouse. [Q8CBQ5-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF411321 mRNA. Translation: AAL04155.1.
AY148879 mRNA. Translation: AAN37399.1.
AK011751 mRNA. Translation: BAB27819.1.
AK016754 mRNA. Translation: BAB30411.1.
AK035523 mRNA. Translation: BAC29091.1.
AK170730 mRNA. Translation: BAE41986.1.
BC010257 mRNA. Translation: AAH10257.1.
BC062144 mRNA. Translation: AAH62144.1.
CCDSiCCDS19287.1. [Q8CBQ5-1]
CCDS39086.1. [Q8CBQ5-2]
RefSeqiNP_080227.2. NM_025951.3. [Q8CBQ5-1]
NP_083020.2. NM_028744.3. [Q8CBQ5-2]
UniGeneiMm.248647.

3D structure databases

ProteinModelPortaliQ8CBQ5.
SMRiQ8CBQ5. Positions 84-438.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000031081.

PTM databases

iPTMnetiQ8CBQ5.
PhosphoSiteiQ8CBQ5.
SwissPalmiQ8CBQ5.

Proteomic databases

EPDiQ8CBQ5.
MaxQBiQ8CBQ5.
PaxDbiQ8CBQ5.
PRIDEiQ8CBQ5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000031081; ENSMUSP00000031081; ENSMUSG00000029186. [Q8CBQ5-1]
ENSMUST00000031082; ENSMUSP00000031082; ENSMUSG00000029186. [Q8CBQ5-2]
GeneIDi67073.
KEGGimmu:67073.
UCSCiuc008xkq.2. mouse. [Q8CBQ5-1]
uc008xkr.2. mouse. [Q8CBQ5-2]

Organism-specific databases

CTDi55300.
MGIiMGI:1914323. Pi4k2b.

Phylogenomic databases

eggNOGiKOG2381. Eukaryota.
ENOG410XP06. LUCA.
GeneTreeiENSGT00390000010434.
HOGENOMiHOG000294076.
HOVERGENiHBG059542.
InParanoidiQ8CBQ5.
KOiK13711.
OMAiCEDLHEL.
OrthoDBiEOG7MKW5Z.
PhylomeDBiQ8CBQ5.
TreeFamiTF314740.

Enzyme and pathway databases

ReactomeiR-MMU-1483248. Synthesis of PIPs at the ER membrane.
R-MMU-1660499. Synthesis of PIPs at the plasma membrane.
R-MMU-1660514. Synthesis of PIPs at the Golgi membrane.
R-MMU-1660516. Synthesis of PIPs at the early endosome membrane.

Miscellaneous databases

NextBioi323492.
PROiQ8CBQ5.
SOURCEiSearch...

Gene expression databases

BgeeiQ8CBQ5.
CleanExiMM_PI4K2B.
ExpressionAtlasiQ8CBQ5. baseline and differential.
GenevisibleiQ8CBQ5. MM.

Family and domain databases

InterProiIPR000403. PI3/4_kinase_cat_dom.
[Graphical view]
PfamiPF00454. PI3_PI4_kinase. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Beta isoform of mouse type II phosphatidylinositol 4-kinase (PI4KIIbeta)."
    Hong W.
    Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
  2. "A gene from our subtracted mouse compacted embryo cDNA library."
    Li W., Lu G.
    Submitted (SEP-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Strain: Kunmingbai.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: C57BL/6J and NOD.
    Tissue: Testis and Urinary bladder.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: FVB/N.
    Tissue: Embryo and Mammary tumor.
  5. "The phagosomal proteome in interferon-gamma-activated macrophages."
    Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
    Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Pancreas and Testis.

Entry informationi

Entry nameiP4K2B_MOUSE
AccessioniPrimary (citable) accession number: Q8CBQ5
Secondary accession number(s): Q91Z30, Q9D072, Q9D471
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: March 1, 2003
Last modified: March 16, 2016
This is version 99 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.