Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NHS-like protein 1

Gene

Nhsl1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
NHS-like protein 1
Gene namesi
Name:Nhsl1
Synonyms:Kiaa1357
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 10

Organism-specific databases

MGIiMGI:106390. Nhsl1.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003413541 – 1587NHS-like protein 1Add BLAST1587

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei24PhosphoserineCombined sources1
Modified residuei197PhosphoserineBy similarity1
Modified residuei328PhosphoserineCombined sources1
Modified residuei563PhosphoserineCombined sources1
Modified residuei629PhosphoserineCombined sources1
Modified residuei1079PhosphoserineCombined sources1
Modified residuei1157PhosphoserineBy similarity1
Modified residuei1218PhosphoserineBy similarity1
Modified residuei1373PhosphoserineCombined sources1
Modified residuei1375PhosphoserineCombined sources1
Modified residuei1379PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8CAF4.
PeptideAtlasiQ8CAF4.
PRIDEiQ8CAF4.

PTM databases

iPTMnetiQ8CAF4.
PhosphoSitePlusiQ8CAF4.

Expressioni

Gene expression databases

BgeeiENSMUSG00000039835.
ExpressionAtlasiQ8CAF4. baseline and differential.
GenevisibleiQ8CAF4. MM.

Interactioni

Protein-protein interaction databases

BioGridi229663. 24 interactors.
IntActiQ8CAF4. 24 interactors.

Structurei

3D structure databases

ProteinModelPortaliQ8CAF4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi884 – 908Ser-richAdd BLAST25
Compositional biasi924 – 1022Pro-richAdd BLAST99

Sequence similaritiesi

Belongs to the NHS family.Curated

Phylogenomic databases

eggNOGiENOG410IJSF. Eukaryota.
ENOG410XXZ7. LUCA.
GeneTreeiENSGT00530000063248.
HOVERGENiHBG108185.
InParanoidiQ8CAF4.
OrthoDBiEOG091G014K.
PhylomeDBiQ8CAF4.
TreeFamiTF333323.

Family and domain databases

InterProiIPR024845. NHS_fam.
[Graphical view]
PfamiPF15273. NHS. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8CAF4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKKDGSSGSF GIKASPGSLS RAVSWINFSS LSRQTKRLFR SDGELSVCGH
60 70 80 90 100
QVEADDENWI YRTQPRKAVS NLDEESRWTV HYTAPWHQQE NVFLPATRPP
110 120 130 140 150
CVEDLHRQAK LNLKSVLREC DKLRQDGCRS SQYYSQGPTF AAGSSPCDDY
160 170 180 190 200
QDEDTEADRK CSLSSSEEER FIGIRRPKTP TSGDFSDLHT QTNWTKSLPL
210 220 230 240 250
PTPEEKTRQQ AQTVQADVVP INITASATGQ DDDGSAHSLY VPDHYSTLGR
260 270 280 290 300
LDSYRSTGQC LETRDTSCQT EDVKVIPPSM RRIRAHKGVG VAAQMSHLSG
310 320 330 340 350
SSGNMSVLSD SAGVVFPSRL SNDTGFHSLP RTGPRASTYS LEGRMGALGS
360 370 380 390 400
TEDTDDTSPY QGGSLQGHEN FAHLGGASST GMLSRPKSQQ LRFLESPACV
410 420 430 440 450
VSPHAAYSTS VIPNATLLSS SEVIVIHTAQ SAGQLDSRTP GSSSYSKIKP
460 470 480 490 500
RDRPTPRCSV KDDHQSPRHH WNEGHLIHSR ALASSVPGAT TLLSLHDSEV
510 520 530 540 550
SLNAPANREN GSQAILYHCR NNPSFPDHPS DVDGKSECSY SGDRGCGSSE
560 570 580 590 600
PWEYKTSSNG RASPLKPHLA TPGCSTPTSN VSSCSLDQTS LKGDTRSLCS
610 620 630 640 650
EDHDGYYTTT HEAGNLYTLS DGLGNPRHSM VNVFDGRAQR SQGDQAAHQD
660 670 680 690 700
KILSRNISLK KAKKPPLPPS RTDSLRRIPK KNNQTNGQVL NESLIASLQH
710 720 730 740 750
SLQLSLPGKG GSSPSQSPCS DFEEPWLPRS RSQSIVSEGS SLTSTTTPNV
760 770 780 790 800
YSLCGVTPSQ SDTSSVKSEY TDPWGYYIDY TSLQEDPGNP TGGCSANTEA
810 820 830 840 850
ATGNGPVRHI QEGSRVPVPQ VPGCSVRPKI ASPEKSQRVT SPSSGYSSQS
860 870 880 890 900
NTPTALTPVP VFLKSMSPAN GKGKAKPKVP ERKSSLISSM SISSSSTSLS
910 920 930 940 950
SNTSTEGSGT MKKLDTTLAS ALAPPPPPLP PLPSPCLADK SPFLPPPPPL
960 970 980 990 1000
ADCSEGSPLP PSPMFPPPPP EALVPFCSPT DGCLSPSPTA VSPSLPRSLP
1010 1020 1030 1040 1050
PVPAPPPFLP SSEPPPAPPL DPKLMKENRP FFKNSSQSES SREALRRPAN
1060 1070 1080 1090 1100
KEEGCRPPMP LITTEALQMV QLRPVRKNSG AGAVLFSEPS AQEQRTPTAP
1110 1120 1130 1140 1150
QYHLKPSAFL KSRNSINEME SESQAASVTS SLPMPAKSQS QGDHDSAVER
1160 1170 1180 1190 1200
GGLPSCSDGA PGPGPSLRTT LLPDSSPSRK PPPISKKPKL FLVVPPPQRD
1210 1220 1230 1240 1250
FTAEPTENGS EAFPGVPSPT RAEGEAVRSQ EEKSSPASRA GSHATAPTPG
1260 1270 1280 1290 1300
SPALEPGTAG SLSSSIVEAN VPMVQPNTSP GPTQEESGEN SVDGERNAKS
1310 1320 1330 1340 1350
CLSQQGREAG LLEPNTAASS SDPVDVSKEE GSDEVLTPTK PRTTEDLFAA
1360 1370 1380 1390 1400
IHRSKRKVLG RKDSEDDHTR NHSPSPPVTP TSAAPNLASP KQVGSIQRSI
1410 1420 1430 1440 1450
KKSTTSSDNF KALLLKKGSR SDTSARMSAA EMLKSTDPRF QRSRSEPSAD
1460 1470 1480 1490 1500
SPDSPSSCSP NKNRRAQEEW AKNEGLMPRS LSFSGPRYSR SRTPPSAASS
1510 1520 1530 1540 1550
RYSMRNRIQS SPMTVISEGE GEPAEPADNK ARRALDATRV CSLDRLTGQE
1560 1570 1580
MDQASLLCSE EPASVDGIGR AEGNGPSEQC GGTEQKS
Length:1,587
Mass (Da):169,419
Last modified:June 10, 2008 - v3
Checksum:i5E63EA1AEAAE412F
GO
Isoform 3 (identifier: Q8CAF4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MKKDGSSGSF...WIYRTQPRKA → MVVFINAKIKSFFKLFKKKT
     224-224: T → TGENFDRQASLRRSLIYTDTLVRRPKKVKRRKTISGIPDIIQKEL

Note: No experimental confirmation available.
Show »
Length:1,583
Mass (Da):169,454
Checksum:iB662E7FEC3BEC450
GO

Sequence cautioni

The sequence AAH13565 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAH30842 differs from that shown. Contaminating sequence. Sequence of unknown origin in the C-terminal part.Curated
The sequence AAH61949 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB30793 differs from that shown. Intron retention.Curated
The sequence BAC31551 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAE22306 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti125Q → R in AAH30842 (PubMed:16141072).Curated1
Sequence conflicti1555S → G in AAH61949 (PubMed:16141072).Curated1
Sequence conflicti1555S → G in BAD90251 (Ref. 4) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0342611 – 68MKKDG…QPRKA → MVVFINAKIKSFFKLFKKKT in isoform 3. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_034263224T → TGENFDRQASLRRSLIYTDT LVRRPKKVKRRKTISGIPDI IQKEL in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC153560 Genomic DNA. No translation available.
AC153561 Genomic DNA. No translation available.
BC013565 mRNA. Translation: AAH13565.2. Different initiation.
BC030842 mRNA. Translation: AAH30842.1. Sequence problems.
BC061949 mRNA. Translation: AAH61949.1. Different initiation.
AK038892 mRNA. Translation: BAC30160.2.
AK017530 mRNA. Translation: BAB30793.1. Sequence problems.
AK043447 mRNA. Translation: BAC31551.1. Different initiation.
AK134837 mRNA. Translation: BAE22306.1. Different initiation.
AK220386 mRNA. Translation: BAD90251.1.
CCDSiCCDS35853.1. [Q8CAF4-1]
CCDS48508.1. [Q8CAF4-3]
RefSeqiNP_001157064.1. NM_001163592.1. [Q8CAF4-3]
NP_775566.3. NM_173390.3. [Q8CAF4-1]
UniGeneiMm.297971.

Genome annotation databases

EnsembliENSMUST00000037341; ENSMUSP00000040799; ENSMUSG00000039835. [Q8CAF4-1]
ENSMUST00000100054; ENSMUSP00000097631; ENSMUSG00000039835. [Q8CAF4-3]
GeneIDi215819.
KEGGimmu:215819.
UCSCiuc007emi.1. mouse. [Q8CAF4-1]
uc007emj.2. mouse. [Q8CAF4-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC153560 Genomic DNA. No translation available.
AC153561 Genomic DNA. No translation available.
BC013565 mRNA. Translation: AAH13565.2. Different initiation.
BC030842 mRNA. Translation: AAH30842.1. Sequence problems.
BC061949 mRNA. Translation: AAH61949.1. Different initiation.
AK038892 mRNA. Translation: BAC30160.2.
AK017530 mRNA. Translation: BAB30793.1. Sequence problems.
AK043447 mRNA. Translation: BAC31551.1. Different initiation.
AK134837 mRNA. Translation: BAE22306.1. Different initiation.
AK220386 mRNA. Translation: BAD90251.1.
CCDSiCCDS35853.1. [Q8CAF4-1]
CCDS48508.1. [Q8CAF4-3]
RefSeqiNP_001157064.1. NM_001163592.1. [Q8CAF4-3]
NP_775566.3. NM_173390.3. [Q8CAF4-1]
UniGeneiMm.297971.

3D structure databases

ProteinModelPortaliQ8CAF4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi229663. 24 interactors.
IntActiQ8CAF4. 24 interactors.

PTM databases

iPTMnetiQ8CAF4.
PhosphoSitePlusiQ8CAF4.

Proteomic databases

PaxDbiQ8CAF4.
PeptideAtlasiQ8CAF4.
PRIDEiQ8CAF4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000037341; ENSMUSP00000040799; ENSMUSG00000039835. [Q8CAF4-1]
ENSMUST00000100054; ENSMUSP00000097631; ENSMUSG00000039835. [Q8CAF4-3]
GeneIDi215819.
KEGGimmu:215819.
UCSCiuc007emi.1. mouse. [Q8CAF4-1]
uc007emj.2. mouse. [Q8CAF4-3]

Organism-specific databases

CTDi57224.
MGIiMGI:106390. Nhsl1.
RougeiSearch...

Phylogenomic databases

eggNOGiENOG410IJSF. Eukaryota.
ENOG410XXZ7. LUCA.
GeneTreeiENSGT00530000063248.
HOVERGENiHBG108185.
InParanoidiQ8CAF4.
OrthoDBiEOG091G014K.
PhylomeDBiQ8CAF4.
TreeFamiTF333323.

Miscellaneous databases

PROiQ8CAF4.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000039835.
ExpressionAtlasiQ8CAF4. baseline and differential.
GenevisibleiQ8CAF4. MM.

Family and domain databases

InterProiIPR024845. NHS_fam.
[Graphical view]
PfamiPF15273. NHS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNHSL1_MOUSE
AccessioniPrimary (citable) accession number: Q8CAF4
Secondary accession number(s): Q5DTY4
, Q6P6Y7, Q8C8Z7, Q8K0R2, Q91YY6, Q9CYM2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: June 10, 2008
Last modified: November 2, 2016
This is version 87 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.