Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Enhancer of polycomb homolog 1

Gene

Epc1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Activator, Chromatin regulator

Keywords - Biological processi

Growth regulation, Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Enhancer of polycomb homolog 1
Gene namesi
Name:Epc1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 18

Organism-specific databases

MGIiMGI:1278322. Epc1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002141541 – 813Enhancer of polycomb homolog 1Add BLAST813

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei538PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8C9X6.
PRIDEiQ8C9X6.

PTM databases

iPTMnetiQ8C9X6.
PhosphoSitePlusiQ8C9X6.

Expressioni

Tissue specificityi

Expressed in adult brain, heart, kidney, liver, lung, skeletal muscle and testis.1 Publication

Gene expression databases

BgeeiENSMUSG00000024240.
CleanExiMM_EPC1.
ExpressionAtlasiQ8C9X6. baseline and differential.
GenevisibleiQ8C9X6. MM.

Interactioni

Subunit structurei

Component of the NuA4 histone acetyltransferase complex which contains the catalytic subunit KAT5/TIP60 and the subunits EP400, TRRAP/PAF400, BRD8/SMAP, EPC1, DMAP1/DNMAP1, RUVBL1/TIP49, RUVBL2, ING3, actin, ACTL6A/BAF53A, MORF4L1/MRG15, MORF4L2/MRGX, MRGBP, YEATS4/GAS41, VPS72/YL1 and MEAF6. HTATTIP/TIP60, EPC1, and ING3 together constitute a minimal HAT complex termed Piccolo NuA4. Component of a NuA4-related complex which contains EP400, TRRAP/PAF400, SRCAP, BRD8/SMAP, EPC1, DMAP1/DNMAP1, RUVBL1/TIP49, RUVBL2, actin, ACTL6A/BAF53A, VPS72 and YEATS4/GAS41. The NuA4 complex interacts with MYC. EPC1 interacts with TRIM27 (By similarity).By similarity

Protein-protein interaction databases

BioGridi199466. 8 interactors.
IntActiQ8C9X6. 3 interactors.
STRINGi10090.ENSMUSP00000028100.

Structurei

3D structure databases

ProteinModelPortaliQ8C9X6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the enhancer of polycomb family.Curated

Phylogenomic databases

eggNOGiKOG2261. Eukaryota.
ENOG410XSSX. LUCA.
GeneTreeiENSGT00390000013262.
HOGENOMiHOG000231800.
HOVERGENiHBG051489.
InParanoidiQ8C9X6.
KOiK11322.
OMAiALSHQVT.
OrthoDBiEOG091G0252.
PhylomeDBiQ8C9X6.
TreeFamiTF106438.

Family and domain databases

InterProiIPR024943. Enhancer_polycomb.
IPR019542. Enhancer_polycomb-like_N.
IPR009607. Enhancer_polycomb_C.
[Graphical view]
PANTHERiPTHR14898. PTHR14898. 1 hit.
PfamiPF06752. E_Pc_C. 1 hit.
PF10513. EPL1. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8C9X6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSKLSFRARA LDASKPLPVF RCEDLPDLHE YASINRAVPQ MPTGMEKEEE
60 70 80 90 100
SEHHLQRAIS AQQVYGEKRD NMVIPVPEAE SNIAYYESIY PGEFRMPKQL
110 120 130 140 150
IHIQPFSLDA EQPDYDLDSE DEVFVNKLKK KMDICPLQFE EMIDRLEKGS
160 170 180 190 200
GQQPVSLQEA KLLLKEDDEL IREVYEYWIK KRKTCRGSSL IPLVKQEKRD
210 220 230 240 250
GSSTNDPYVA FRRRTEKMQT RKNRKNDEAS YEKMLKLRRD LSRAVTILEM
260 270 280 290 300
IKRREKSKRE LLHLTLEIME KRYNLGDYSG EIMSEVMAQR QPVKPTYAIP
310 320 330 340 350
IIPITNSSQF KHQDATDSKE FKVNKQDKAD LIRPKRKYEK KPKVLPPSAA
360 370 380 390 400
APQQQSPAAL PGFSAKDLNQ YDFPSSDEEP LSQVLSGSSE AEEENDPDGP
410 420 430 440 450
FAFRRKAGCQ YYAPHLDQTG NWPWTSPKDG GLGDVRYRYC LTTLTVPQRC
460 470 480 490 500
LGFARRRVGR GGRVVLDRAH SDYDSMFHHL DLDMLSSPQP SPVNQFANTS
510 520 530 540 550
EPNTSDRSSS KDLSQILVDI KSCRWRHFRP RTPSLPDSDS GELSSRKLHR
560 570 580 590 600
SISRAGAAQP GAHTCSTSTQ NRSSSGSAHC AFTAEQYQQH QQQLALMQQQ
610 620 630 640 650
QLAQTQQQQQ ANSSSSAAAQ QGFVSKTLDS ASAQFAASAL MTSEQLLGFK
660 670 680 690 700
VKDDVVLGLG VNGVLPASGV YKGLHLSSTT PTALVHTSPS TAGSTLLQPS
710 720 730 740 750
NITQTSGSHS SLSHQVTAAS SATTQVLFGN NIRLTVPSSV PTVNSVTPIN
760 770 780 790 800
ARHIPRTLSA VPPSALKLAA AANCQVSKVP SSSSVDSVPR ENHESEKPAL
810
NNIADNTVAM EVT
Length:813
Mass (Da):90,411
Last modified:March 1, 2003 - v1
Checksum:iE6F3CD987FC55905
GO
Isoform 2 (identifier: Q8C9X6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MSKLSFRARALDASKPLPVFRCEDLPDLHEYASINRAVPQMPTGMEKEEES → M

Show »
Length:763
Mass (Da):84,767
Checksum:iD13649721FFB41E2
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0128781 – 51MSKLS…KEEES → M in isoform 2. 1 PublicationAdd BLAST51

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF079765 mRNA. Translation: AAC64272.1.
AK040254 mRNA. Translation: BAC30552.1.
BC138622 mRNA. Translation: AAI38623.1.
BC138623 mRNA. Translation: AAI38624.1.
CCDSiCCDS29041.1. [Q8C9X6-1]
CCDS37726.1. [Q8C9X6-2]
RefSeqiNP_001263279.1. NM_001276350.1.
NP_031961.1. NM_007935.2. [Q8C9X6-2]
NP_081773.1. NM_027497.3. [Q8C9X6-1]
UniGeneiMm.312133.

Genome annotation databases

EnsembliENSMUST00000028100; ENSMUSP00000028100; ENSMUSG00000024240. [Q8C9X6-1]
ENSMUST00000115870; ENSMUSP00000111536; ENSMUSG00000024240. [Q8C9X6-2]
GeneIDi13831.
KEGGimmu:13831.
UCSCiuc008dzi.2. mouse. [Q8C9X6-1]
uc008dzj.2. mouse. [Q8C9X6-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF079765 mRNA. Translation: AAC64272.1.
AK040254 mRNA. Translation: BAC30552.1.
BC138622 mRNA. Translation: AAI38623.1.
BC138623 mRNA. Translation: AAI38624.1.
CCDSiCCDS29041.1. [Q8C9X6-1]
CCDS37726.1. [Q8C9X6-2]
RefSeqiNP_001263279.1. NM_001276350.1.
NP_031961.1. NM_007935.2. [Q8C9X6-2]
NP_081773.1. NM_027497.3. [Q8C9X6-1]
UniGeneiMm.312133.

3D structure databases

ProteinModelPortaliQ8C9X6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi199466. 8 interactors.
IntActiQ8C9X6. 3 interactors.
STRINGi10090.ENSMUSP00000028100.

PTM databases

iPTMnetiQ8C9X6.
PhosphoSitePlusiQ8C9X6.

Proteomic databases

PaxDbiQ8C9X6.
PRIDEiQ8C9X6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000028100; ENSMUSP00000028100; ENSMUSG00000024240. [Q8C9X6-1]
ENSMUST00000115870; ENSMUSP00000111536; ENSMUSG00000024240. [Q8C9X6-2]
GeneIDi13831.
KEGGimmu:13831.
UCSCiuc008dzi.2. mouse. [Q8C9X6-1]
uc008dzj.2. mouse. [Q8C9X6-2]

Organism-specific databases

CTDi80314.
MGIiMGI:1278322. Epc1.

Phylogenomic databases

eggNOGiKOG2261. Eukaryota.
ENOG410XSSX. LUCA.
GeneTreeiENSGT00390000013262.
HOGENOMiHOG000231800.
HOVERGENiHBG051489.
InParanoidiQ8C9X6.
KOiK11322.
OMAiALSHQVT.
OrthoDBiEOG091G0252.
PhylomeDBiQ8C9X6.
TreeFamiTF106438.

Miscellaneous databases

ChiTaRSiEpc1. mouse.
PROiQ8C9X6.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000024240.
CleanExiMM_EPC1.
ExpressionAtlasiQ8C9X6. baseline and differential.
GenevisibleiQ8C9X6. MM.

Family and domain databases

InterProiIPR024943. Enhancer_polycomb.
IPR019542. Enhancer_polycomb-like_N.
IPR009607. Enhancer_polycomb_C.
[Graphical view]
PANTHERiPTHR14898. PTHR14898. 1 hit.
PfamiPF06752. E_Pc_C. 1 hit.
PF10513. EPL1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiEPC1_MOUSE
AccessioniPrimary (citable) accession number: Q8C9X6
Secondary accession number(s): B2RRY2, Q9Z299
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: March 1, 2003
Last modified: November 2, 2016
This is version 105 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.