Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ankyrin-2

Gene

Ank2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Attaches integral membrane proteins to cytoskeletal elements. Also binds to cytoskeletal proteins. Required for coordinate assembly of Na/Ca exchanger, Na/K ATPase and InsP3 receptor at sarcoplasmic reticulum sites in cardiomyocytes (By similarity). Required for the coordinated expression of the Na/K ATPase, Na/Ca exchanger and beta-2-spectrin (SPTBN1) in the inner segment of rod photoreceptors. Required for expression and targeting of SPTBN1 in neonatal cardiomyocytes and for the regulation of neonatal cardiomyocyte contraction rate. In skeletal muscle, required for proper localization of DMD and DCTN4 and for the formation and/or stability of a special subset of microtubules associated with costameres and neuromuscular junctions.By similarity3 Publications

GO - Molecular functioni

  • ATPase binding Source: BHF-UCL
  • cytoskeletal adaptor activity Source: GO_Central
  • ion channel binding Source: BHF-UCL
  • potassium channel regulator activity Source: MGI
  • protein binding, bridging Source: BHF-UCL
  • spectrin binding Source: GO_Central

GO - Biological processi

  • atrial cardiac muscle cell action potential Source: BHF-UCL
  • atrial cardiac muscle cell to AV node cell communication Source: BHF-UCL
  • cardiac muscle contraction Source: MGI
  • cellular calcium ion homeostasis Source: BHF-UCL
  • cellular protein localization Source: BHF-UCL
  • positive regulation of calcium ion transmembrane transporter activity Source: BHF-UCL
  • positive regulation of calcium ion transport Source: BHF-UCL
  • positive regulation of cation channel activity Source: BHF-UCL
  • positive regulation of gene expression Source: BHF-UCL
  • positive regulation of potassium ion transmembrane transporter activity Source: BHF-UCL
  • positive regulation of potassium ion transport Source: BHF-UCL
  • protein localization Source: MGI
  • protein localization to cell surface Source: UniProtKB
  • protein localization to endoplasmic reticulum Source: BHF-UCL
  • protein localization to M-band Source: BHF-UCL
  • protein localization to plasma membrane Source: BHF-UCL
  • protein localization to T-tubule Source: BHF-UCL
  • protein stabilization Source: BHF-UCL
  • protein targeting to plasma membrane Source: MGI
  • regulation of atrial cardiac muscle cell action potential Source: BHF-UCL
  • regulation of AV node cell action potential Source: BHF-UCL
  • regulation of calcium ion transmembrane transporter activity Source: BHF-UCL
  • regulation of calcium ion transport Source: BHF-UCL
  • regulation of cardiac muscle cell contraction Source: BHF-UCL
  • regulation of cardiac muscle cell membrane potential Source: MGI
  • regulation of cardiac muscle contraction Source: BHF-UCL
  • regulation of cardiac muscle contraction by calcium ion signaling Source: BHF-UCL
  • regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion Source: BHF-UCL
  • regulation of cation channel activity Source: MGI
  • regulation of heart rate Source: BHF-UCL
  • regulation of heart rate by cardiac conduction Source: BHF-UCL
  • regulation of protein stability Source: BHF-UCL
  • regulation of SA node cell action potential Source: BHF-UCL
  • SA node cell action potential Source: BHF-UCL
  • SA node cell to atrial cardiac muscle cell communication Source: BHF-UCL
  • T-tubule organization Source: BHF-UCL
Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-MMU-445095. Interaction between L1 and Ankyrins.
R-MMU-6807878. COPI-mediated anterograde transport.

Names & Taxonomyi

Protein namesi
Recommended name:
Ankyrin-2By similarity
Short name:
ANK-2
Alternative name(s):
Ankyrin-B2 Publications
Brain ankyrinBy similarityImported
Gene namesi
Name:Ank2Imported
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 3

Organism-specific databases

MGIiMGI:88025. Ank2.

Subcellular locationi

GO - Cellular componenti

  • A band Source: BHF-UCL
  • apical plasma membrane Source: UniProtKB-SubCell
  • costamere Source: BHF-UCL
  • cytoplasm Source: MGI
  • cytoskeleton Source: UniProtKB-SubCell
  • integral component of plasma membrane Source: UniProtKB
  • intercalated disc Source: BHF-UCL
  • intracellular Source: BHF-UCL
  • M band Source: BHF-UCL
  • perinuclear region of cytoplasm Source: MGI
  • plasma membrane Source: BHF-UCL
  • postsynaptic density Source: MGI
  • postsynaptic membrane Source: UniProtKB-SubCell
  • sarcolemma Source: BHF-UCL
  • T-tubule Source: BHF-UCL
  • Z disc Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Cytoskeleton, Membrane, Postsynaptic cell membrane, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003640871 – 3898Ankyrin-2Add BLAST3898

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei31PhosphoserineCombined sources1
Modified residuei34PhosphoserineCombined sources1
Modified residuei378PhosphotyrosineCombined sources1
Modified residuei531PhosphotyrosineCombined sources1
Modified residuei846PhosphoserineCombined sources1
Modified residuei853PhosphothreonineCombined sources1
Modified residuei874PhosphoserineCombined sources1
Modified residuei1349PhosphotyrosineCombined sources1
Modified residuei1426PhosphoserineCombined sources1
Modified residuei1428PhosphoserineCombined sources1
Modified residuei1440PhosphoserineCombined sources1
Modified residuei1467PhosphoserineCombined sources1
Modified residuei1562PhosphoserineCombined sources1
Modified residuei1699PhosphoserineCombined sources1
Modified residuei1700PhosphoserineCombined sources1
Modified residuei1703PhosphoserineCombined sources1
Modified residuei1816PhosphoserineCombined sources1
Modified residuei1819PhosphoserineCombined sources1
Modified residuei1889PhosphoserineCombined sources1
Modified residuei2090PhosphoserineCombined sources1
Modified residuei2202PhosphothreonineCombined sources1
Modified residuei2206PhosphoserineCombined sources1
Modified residuei2232PhosphothreonineCombined sources1
Modified residuei2238PhosphoserineCombined sources1
Modified residuei2333PhosphothreonineCombined sources1
Modified residuei2364PhosphoserineCombined sources1
Modified residuei2399PhosphoserineCombined sources1
Modified residuei2413PhosphoserineCombined sources1
Modified residuei2475PhosphoserineCombined sources1
Modified residuei2480PhosphoserineCombined sources1
Modified residuei2542PhosphothreonineCombined sources1
Modified residuei2639PhosphoserineCombined sources1
Modified residuei2661PhosphoserineCombined sources1
Modified residuei2741PhosphoserineCombined sources1
Modified residuei2755PhosphoserineCombined sources1
Modified residuei2913PhosphoserineCombined sources1
Modified residuei3032PhosphoserineCombined sources1
Modified residuei3035PhosphothreonineCombined sources1
Modified residuei3226PhosphoserineCombined sources1
Modified residuei3229PhosphoserineCombined sources1
Modified residuei3230PhosphoserineCombined sources1
Modified residuei3343PhosphoserineCombined sources1
Modified residuei3362PhosphoserineCombined sources1
Modified residuei3427PhosphoserineCombined sources1
Modified residuei3686PhosphoserineCombined sources1
Modified residuei3692PhosphoserineCombined sources1
Modified residuei3718PhosphothreonineCombined sources1
Modified residuei3739PhosphothreonineCombined sources1
Modified residuei3745PhosphothreonineCombined sources1
Modified residuei3756PhosphothreonineCombined sources1
Modified residuei3759PhosphothreonineCombined sources1
Modified residuei3764PhosphoserineCombined sources1
Modified residuei3850PhosphoserineCombined sources1
Isoform 21 Publication (identifier: Q8C8R3-2)
Modified residuei30PhosphoserineCombined sources1
Isoform 71 Publication (identifier: Q8C8R3-7)
Modified residuei44PhosphoserineCombined sources1
Isoform 32 Publications (identifier: Q8C8R3-3)
Modified residuei590PhosphoserineCombined sourcesCurated1

Post-translational modificationi

Phosphorylated at multiple sites by different protein kinases and each phosphorylation event regulates the protein's structure and function.By similarityCurated

Keywords - PTMi

Phosphoprotein

Proteomic databases

PeptideAtlasiQ8C8R3.
PRIDEiQ8C8R3.

PTM databases

iPTMnetiQ8C8R3.
PhosphoSitePlusiQ8C8R3.
SwissPalmiQ8C8R3.

Expressioni

Tissue specificityi

Detected in eye lens fiber cells (at protein level) (PubMed:21745462). Present in skeletal muscle, kidney, lung, testes, spleen and lung. In the pancreas, highly expressed in islets and concentrated in beta cells. Expressed in Purkinje neurons in cerebellum. Expression in the central nerve tracts in forebrain and cerebellum is elevated in the myelinate-deficient strain Shiverer. Expressed in the inner segments of rod photoreceptors in retina.5 Publications

Developmental stagei

Expressed in neonatal developing ventricular cardiomyocytes as well as adult cardiomyocytes.1 Publication

Gene expression databases

BgeeiENSMUSG00000032826.
ExpressionAtlasiQ8C8R3. baseline and differential.
GenevisibleiQ8C8R3. MM.

Interactioni

Subunit structurei

Interacts with RHBG and SPTBN1 (By similarity). Colocalizes with Na/K ATPase, Na/Ca exchanger and SPTBN1. Directly interacts with DMD; this interaction is necessary for DMD localization at the sarcolemma. Interacts with DCTN4; this interaction is required for DCTN4 retention at costameres (PubMed:19109891). Identified in complexes that contain VIM, EZR, AHNAK, BFSP1, BFSP2, ANK2, PLEC, PRX and spectrin (PubMed:21745462).By similarity4 Publications

GO - Molecular functioni

  • ATPase binding Source: BHF-UCL
  • cytoskeletal adaptor activity Source: GO_Central
  • ion channel binding Source: BHF-UCL
  • protein binding, bridging Source: BHF-UCL
  • spectrin binding Source: GO_Central

Protein-protein interaction databases

BioGridi224951. 1 interactor.
DIPiDIP-58645N.
IntActiQ8C8R3. 13 interactors.
MINTiMINT-4114787.

Structurei

3D structure databases

ProteinModelPortaliQ8C8R3.
SMRiQ8C8R3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati30 – 62ANK 1Add BLAST33
Repeati63 – 92ANK 2Add BLAST30
Repeati96 – 125ANK 3Add BLAST30
Repeati129 – 158ANK 4Add BLAST30
Repeati162 – 191ANK 5Add BLAST30
Repeati193 – 220ANK 6Add BLAST28
Repeati232 – 261ANK 7Add BLAST30
Repeati265 – 294ANK 8Add BLAST30
Repeati298 – 327ANK 9Add BLAST30
Repeati331 – 360ANK 10Add BLAST30
Repeati364 – 393ANK 11Add BLAST30
Repeati397 – 426ANK 12Add BLAST30
Repeati430 – 459ANK 13Add BLAST30
Repeati463 – 492ANK 14Add BLAST30
Repeati496 – 525ANK 15Add BLAST30
Repeati529 – 558ANK 16Add BLAST30
Repeati562 – 591ANK 17Add BLAST30
Repeati595 – 624ANK 18Add BLAST30
Repeati628 – 657ANK 19Add BLAST30
Repeati661 – 690ANK 20Add BLAST30
Repeati694 – 723ANK 21Add BLAST30
Repeati727 – 756ANK 22Add BLAST30
Repeati760 – 789ANK 23Add BLAST30
Repeati793 – 822ANK 24Add BLAST30
Domaini966 – 1091ZU5 1PROSITE-ProRule annotationAdd BLAST126
Domaini1092 – 1255ZU5 2PROSITE-ProRule annotationAdd BLAST164
Domaini1417 – 1502Death 1PROSITE-ProRule annotationAdd BLAST86
Domaini3522 – 3606Death 2PROSITE-ProRule annotationAdd BLAST85

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni966 – 1125Interaction with SPTBN1By similarityAdd BLAST160
Regioni1256 – 1390UPA domainBy similarityAdd BLAST135

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi1777 – 1855Ser-richAdd BLAST79
Compositional biasi2620 – 2626Poly-Ser7

Domaini

The tandem configuration of the two ZU5 and the UPA domains forms a structural supramodule termed ZZU. ZU5-1 mediates interaction with beta-spectrin, and the ZU5-1/UPA interface is required for ankyrin's function other than binding to spectrin (By similarity).By similarity

Sequence similaritiesi

Contains 24 ANK repeats.PROSITE-ProRule annotation
Contains 2 death domains.PROSITE-ProRule annotation
Contains 2 ZU5 domains.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

GeneTreeiENSGT00840000129677.
HOVERGENiHBG100442.
InParanoidiQ8C8R3.
PhylomeDBiQ8C8R3.
TreeFamiTF351263.

Family and domain databases

Gene3Di1.10.533.10. 1 hit.
1.25.40.20. 3 hits.
InterProiIPR030301. Ankyrin-B.
IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR011029. DEATH-like_dom.
IPR000488. Death_domain.
IPR000906. ZU5_dom.
[Graphical view]
PANTHERiPTHR24123:SF17. PTHR24123:SF17. 3 hits.
PfamiPF00023. Ank. 2 hits.
PF12796. Ank_2. 6 hits.
PF00531. Death. 1 hit.
PF00791. ZU5. 2 hits.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 23 hits.
SM00005. DEATH. 1 hit.
SM00218. ZU5. 1 hit.
[Graphical view]
SUPFAMiSSF47986. SSF47986. 1 hit.
SSF48403. SSF48403. 3 hits.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 20 hits.
PS50017. DEATH_DOMAIN. 1 hit.
PS51145. ZU5. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8C8R3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMNEDAAQKS DSGEKFNGSS QRRKRPKKSD SNASFLRAAR AGNLDKVVEY
60 70 80 90 100
LKGGIDINTC NQNGLNALHL AAKEGHVGLV QELLGRGSSV DSATKKGNTA
110 120 130 140 150
LHIASLAGQA EVVKVLVKEG ANINAQSQNG FTPLYMAAQE NHIDVVKYLL
160 170 180 190 200
ENGANQSTAT EDGFTPLAVA LQQGHNQAVA ILLENDTKGK VRLPALHIAA
210 220 230 240 250
RKDDTKSAAL LLQNDHNADV QSKMMVNRTT ESGFTPLHIA AHYGNVNVAT
260 270 280 290 300
LLLNRGAAVD FTARNGITPL HVASKRGNTN MVKLLLDRGG QIDAKTRDGL
310 320 330 340 350
TPLHCAARSG HDQVVELLLE RKAPLLARTK NGLSPLHMAA QGDHVECVKH
360 370 380 390 400
LLQYKAPVDD VTLDYLTALH VAAHCGHYRV TKLLLDKRAN PNARALNGFT
410 420 430 440 450
PLHIACKKNR IKVMELLVKY GASIQAITES GLTPIHVAAF MGHLNIVLLL
460 470 480 490 500
LQNGASPDVT NIRGETALHM AARAGQVEVV RCLLRNGALV DARAREEQTP
510 520 530 540 550
LHIASRLGKT EIVQLLLQHM AHPDAATTNG YTPLHISARE GQVDVASVLL
560 570 580 590 600
EAGAAHSLAT KKGFTPLHVA AKYGSLDVAK LLLQRRAAAD SAGKNGLTPL
610 620 630 640 650
HVAAHYDNQK VALLLLEKGA SPHATAKNGY TPLHIAAKKN QMQIASTLLN
660 670 680 690 700
YGAETNTVTK QGVTPLHLAS QEGHTDMVTL LLDKGANIHM STKSGLTSLH
710 720 730 740 750
LAAQEDKVNV ADILTKHGAD RDAYTKLGYT PLIVACHYGN VKMVNFLLKQ
760 770 780 790 800
GANVNAKTKN GYTPLHQAAQ QGHTHIINVL LQHGAKPNAT TANGNTALAI
810 820 830 840 850
AKRLGYISVV DTLKVVTEEV TTTTTTITEK HKLNVPETMT EVLDVSDEEG
860 870 880 890 900
DDTVTGDGGE YLRPEDLKEL GDDSLPSSQF LDGMNYLRYS LEGGRSDSLR
910 920 930 940 950
SFSSDRSHTL SHASYLRDSA MIDDTVVIPS HQVSALAKEA ERNSYRLSWG
960 970 980 990 1000
TENLDNVALS SSPIHSGFLV SFMVDARGGA MRGCRHNGLR IIIPPRKCTA
1010 1020 1030 1040 1050
PTRVTCRLVK RHRLATMPPM VEGEGLASRL IEVGPSGAQF LGPVIVEIPH
1060 1070 1080 1090 1100
FAALRGKERE LVVLRSENGD SWKEHFCDYT EDELNEILNG MDEVLDSPED
1110 1120 1130 1140 1150
LEKKRICRII TRDFPQYFAV VSRIKQDSNL IGPEGGVLSS TVVSQVQAVF
1160 1170 1180 1190 1200
PEGALTKRIR VGLQAQPMHS ELVKKILGNK ATFSPIVTLE PRRRKFHKPI
1210 1220 1230 1240 1250
TMTIPVPKAS SDVMLNGFGG DAPTLRLLCS ITGGTTPAQW EDITGTTPLT
1260 1270 1280 1290 1300
FVNECVSFTT NVSARFWLID CRQIQESVAF ASQVYREIIC VPYMAKFVVF
1310 1320 1330 1340 1350
AKSHDPIEAR LRCFCMTDDK VDKTLEQQEN FSEVARSRDV EVLEGKPIYV
1360 1370 1380 1390 1400
DCFGNLVPLT KSGQHHIFSF FAFKENRLPL FVKVRDTTQE PCGRLSFMKE
1410 1420 1430 1440 1450
PKSTRGLVHQ AICNLNITLP IYAKESESDQ EPEEEIGMTS EKNDETESTE
1460 1470 1480 1490 1500
TSVLKSHLVN EVPVLASPDL LSEVSEMKQD LIKMTAILTT DVSDKAGSLK
1510 1520 1530 1540 1550
VKELAKAGEE EPGEPFEIVE RVKEDLEKVN AILRSGTCMR DEGRARSSQS
1560 1570 1580 1590 1600
ERELEEEWVI VSDEEIQEAK QHAPVEIDEH PCIEVRVDRE TKAKVEKDST
1610 1620 1630 1640 1650
GLVNYLTDDL NSYTSPHEKK PHTAPEKSGE TSQASAVGKS SESNKGKATS
1660 1670 1680 1690 1700
AEEKQSAQKQ LKPGLAIKKP VRRKLKEKQK QKEESSQSSE EKTELKKGSS
1710 1720 1730 1740 1750
EESVDEDRGL VPEPLPTAKA TSPLIEETPI GSIKDKVKAL QKRVEDEQKG
1760 1770 1780 1790 1800
RSKLPVRVKG KEDVPKRTTP RTHPAVSPSS KSSTSSKAER HSSLSSSAKP
1810 1820 1830 1840 1850
ERHTPVSPSS KNEKLSPVSP SAKTERHSPV FSGKPEKHSP GSPSTKNERH
1860 1870 1880 1890 1900
SPVSSLKTER HTPGSPSGKT DKRPPVPSSG RTEKHPPVSP GKTEKHLPGS
1910 1920 1930 1940 1950
PSIRTPEKPA PGSATGKHEK HLPVSPGKTE KQPPISPTSK TERIEETMSV
1960 1970 1980 1990 2000
RELMKAFQSG QDPSKHKTGL FEHKSAKQKQ PQDKSKSRVE KEKGHTVTQR
2010 2020 2030 2040 2050
EVTQRETQRI ESQTAKRGQR FQVSAATESR RFRSTTITVG LRMEDPVRER
2060 2070 2080 2090 2100
FERTPIIKTP EVVPSVAAEE SHRGSEKIVD EQGDMDFQIS PDRKTSTDFS
2110 2120 2130 2140 2150
EVIKQELEDN DKYQQFRLTE DTEKAQVHLD QVITSPFNTA FPLDYMKDEF
2160 2170 2180 2190 2200
LPALSLQSGA LGGSSESLKQ EVIAGSPCSS LMEGTPQISS EESYKHEGLA
2210 2220 2230 2240 2250
ETPETSPESL SFSPKKSEEQ IGEAKETTKV GTPTDIHSEK ELPITNDITD
2260 2270 2280 2290 2300
SSQKQGAGVT RGSEPSTEHS QKEVTQDPHK DVCSKQDGCP ESQSVSLASE
2310 2320 2330 2340 2350
VFTEKGSCGE SQLPLVSSAF KTQSESETQE SLTPSEVTKP FPPSDASVKT
2360 2370 2380 2390 2400
AEGTEPKPQG AIRSPQGLEL PLPNRDSEVL SPMADESLAV SHKDSLEASP
2410 2420 2430 2440 2450
VLEDNSSHKT PDSLEPSPLK ESPCRDSLES SPVEPKMKAG ILPSHFPLPA
2460 2470 2480 2490 2500
AIAKTDLVAE VASMRSRLLR DPDGSAEDDS LEQTSLMESS GKSPLSPDTP
2510 2520 2530 2540 2550
SSEEVSYEVT PKPSDSSTPK PAVIHECAEE DDSENGEKKR FTPEEEMFKM
2560 2570 2580 2590 2600
VTKIKTFDEL EQEAKQKRDY KKEPRQDGSS SASDPDADYS AEVNDEKQMA
2610 2620 2630 2640 2650
GTEGEGEVPV LVTSENRKVS SSSSESEPEL TQLSKGADSG LLTEPVIRVQ
2660 2670 2680 2690 2700
PPSPLPSSID SNSSPEEATQ FQPIVPKQYT FKMNEEIQEE PATSEDKDCK
2710 2720 2730 2740 2750
SHLAEDSQTH SADAADGSDG DLNRETTQPE TCDGHGCETV SPSNSATPVS
2760 2770 2780 2790 2800
LGVQSPEHKD VDKPLAIDKD SLAHQDTCEN DREEREFDPS GVESTQADLP
2810 2820 2830 2840 2850
NESSSLSSRC AIPEGNESAK EIASPSSPVK VEVTITDQAL ESMPEDCPIQ
2860 2870 2880 2890 2900
DSSTTMQTER FAMDVPVSEL AETDENSDPQ IISPYENVPS SSFFSAEPSK
2910 2920 2930 2940 2950
IQTDTCHSTV VHSPEVYSVI IRSSPEDVVV TNSSNRTVSG EESHCESHDL
2960 2970 2980 2990 3000
ETESEQKSAL WAAQSDAPPL AVAPTASDAA SVTGEQASKV IITKTDADAD
3010 3020 3030 3040 3050
SWSEIREDDA AFEARVKEEE QKIFGLMVDR QSQGTTPDTT PARTPTEEGT
3060 3070 3080 3090 3100
PTSEQNPFLF QEGKLFEMTR SGAIDMTKRP YADESLHFFQ IGQESNEEAI
3110 3120 3130 3140 3150
SEDLKEGATG AEPPQTETTS ESLELSEPKE AMDDEGELLP DDVSEEIEDL
3160 3170 3180 3190 3200
PASDANIDSQ VIISASTETP TKEAVSTAVE EPPTTQRSDS LSTVKQTPRP
3210 3220 3230 3240 3250
AVPGPVGQLD FSPVTRSVYS GQDDESPESS PEEQKSVIEI PTAPVDNVPS
3260 3270 3280 3290 3300
AESKPQIPIR TLPTLVPAPP SAEDESAFSD DFPSSLDEDS KEGGAKPKSK
3310 3320 3330 3340 3350
IPVKAPTQRT EWQPSPTDIP LQKTAVPQGQ ETLSRAPDGR SKSESDASSL
3360 3370 3380 3390 3400
DAKTKCPVKA RSYIETETES RERAEGFESE SEDGATKPKL FASRLPVKSR
3410 3420 3430 3440 3450
STSSSGRPGT SPTRESREHF FDLYRNSIEF FEEISDEASK LVDRLTQSER
3460 3470 3480 3490 3500
EQEPPSDDES SSALEVSVIE SLPPVDIEHS APEDIFDTRP IWDESIETMI
3510 3520 3530 3540 3550
ERIPDENGHD RAEDPQDEQE RMEERLAYIA DHLGFSWTEL ARELDFTEEQ
3560 3570 3580 3590 3600
IHQIRIENPN SLQDQSHALL KYWLERDGKH ATDTILIECL TKINRMDIVH
3610 3620 3630 3640 3650
LLETNTEPLQ ERMGRSYAEI EQTITLDHSE GFSVLPDELC AAKEKKEQEA
3660 3670 3680 3690 3700
SKESESSDHP PMVSEEDISV GYSTFQDCLP KTEGDSPAAA LSPQMHQEPV
3710 3720 3730 3740 3750
QQDFSGKTQD QQEYYVTTPG AEVEDPQKAT AVPDSLCKTP EDISTPPEGT
3760 3770 3780 3790 3800
KPCLQTPVTS ERGSPIVQEP EEASEPKEES SPRKTSLVIV ESTDDQSQVF
3810 3820 3830 3840 3850
ERLDGDAAFQ KGDDMPDIPP ETVTEEEYVD ENGHTVVKKV TRKIIRRYVS
3860 3870 3880 3890
SDGTEKEEVT MQGMPQEPVN IEDGDNYSKV IKRVVLKSDT QQSEDNNE
Note: Gene prediction based on similarity to human ortholog.Curated
Length:3,898
Mass (Da):426,261
Last modified:February 10, 2009 - v2
Checksum:iA779A20AA489DB34
GO
Isoform 21 Publication (identifier: Q8C8R3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-28: MMNEDAAQKSDSGEKFNGSSQRRKRPKK → MASPTSPGPEGGACTPQNPPRIRQ
     899-902: LRSF → TIP
     1042-1042: G → GKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLG

Note: Incomplete sequence.Combined sources
Show »
Length:3,926
Mass (Da):428,767
Checksum:i5700F24EFF6228B6
GO
Isoform 32 Publications (identifier: Q8C8R3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-838: Missing.
     1444-3514: Missing.
     3894-3894: E → EVTLSEPSVLSSTSQFQAEPVEGRRVSKVVKTTMVHGERMEKSLGDSSLATDLPSAKDDFEE

Show »
Length:1,050
Mass (Da):117,436
Checksum:iB0DD8C0591A8F177
GO
Isoform 42 Publications (identifier: Q8C8R3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     3894-3894: E → EVTLSEPSVLSSTSQFQAEPVEGRRVSKVVKTTMVHGERMEKSLGDSSLATDLPSAKDDFEE

Show »
Length:3,959
Mass (Da):432,868
Checksum:i949ECF87E41382EB
GO
Isoform 51 Publication (identifier: Q8C8R3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: MMNEDAAQKSDSGEKFNGSSQRRKRPK → MTTMLQ
     597-629: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:3,844
Mass (Da):420,441
Checksum:i30718DB2D22D5BDA
GO
Isoform 61 Publication (identifier: Q8C8R3-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-28: MMNEDAAQKSDSGEKFNGSSQRRKRPKK → MTTMLQKSQNKCESQTTCNEVTQSSCIQRKDPNGVHPDDQ
     224-231: Missing.
     463-477: RGETALHMAARAGQV → MQPKWESMSLSAEPV
     478-3898: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:481
Mass (Da):51,692
Checksum:i4C11DDF023C8DBF7
GO
Isoform 71 Publication (identifier: Q8C8R3-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: MMNEDAAQKSDSGEKFNGSSQRRKRPK → MAHAAASIKKVREAELDEKEKNLDRERKKQRKIPRDRMERKR
     397-439: NGFTPLHIAC...SGLTPIHVAA → VNLAQSTFTQ...TAKLFPPLNH
     440-3898: Missing.

Show »
Length:454
Mass (Da):49,541
Checksum:iC37BE425FC551178
GO
Isoform 81 Publication (identifier: Q8C8R3-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: MMNEDAAQKSDSGEKFNGSSQRRKRPK → MATMLQ
     397-439: NGFTPLHIAC...SGLTPIHVAA → VNLAQSTFTQ...TAKLFPPLNH
     440-3898: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:418
Mass (Da):45,089
Checksum:i569E099E5BC76567
GO

Sequence cautioni

The sequence AK036018 differs from that shown. Reason: Frameshift at position 1002.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti1026L → Q in BAC27676 (PubMed:16141072).Curated1
Sequence conflicti1112R → H in BAC27676 (PubMed:16141072).Curated1
Sequence conflicti3649E → K in BAC27676 (PubMed:16141072).Curated1
Sequence conflicti3731A → T in AAH43123 (PubMed:15489334).Curated1
Isoform 32 Publications (identifier: Q8C8R3-3)
Sequence conflicti1014V → A in BAC27676 (PubMed:16141072).Combined sourcesCurated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0530101 – 838Missing in isoform 3. 2 PublicationsAdd BLAST838
Alternative sequenceiVSP_0530111 – 28MMNED…KRPKK → MASPTSPGPEGGACTPQNPP RIRQ in isoform 2. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_0530121 – 28MMNED…KRPKK → MTTMLQKSQNKCESQTTCNE VTQSSCIQRKDPNGVHPDDQ in isoform 6. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_0530131 – 27MMNED…RKRPK → MTTMLQ in isoform 5. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_0530141 – 27MMNED…RKRPK → MAHAAASIKKVREAELDEKE KNLDRERKKQRKIPRDRMER KR in isoform 7. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_0530151 – 27MMNED…RKRPK → MATMLQ in isoform 8. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_053016224 – 231Missing in isoform 6. 1 Publication8
Alternative sequenceiVSP_053017397 – 439NGFTP…IHVAA → VNLAQSTFTQCSKTTLLGQR HLHQCKSMDLWLITAKLFPP LNH in isoform 7 and isoform 8. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_053018440 – 3898Missing in isoform 7 and isoform 8. 1 PublicationAdd BLAST3459
Alternative sequenceiVSP_053019463 – 477RGETA…RAGQV → MQPKWESMSLSAEPV in isoform 6. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_053020478 – 3898Missing in isoform 6. 1 PublicationAdd BLAST3421
Alternative sequenceiVSP_053021597 – 629Missing in isoform 5. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_053023899 – 902LRSF → TIP in isoform 2. 1 Publication4
Alternative sequenceiVSP_0530251042G → GKLHLPTAPPPLNEGESLVS RILQLGPPGTKFLG in isoform 2. 1 Publication1
Alternative sequenceiVSP_0530271444 – 3514Missing in isoform 3. 2 PublicationsAdd BLAST2071
Alternative sequenceiVSP_0530293894E → EVTLSEPSVLSSTSQFQAEP VEGRRVSKVVKTTMVHGERM EKSLGDSSLATDLPSAKDDF EE in isoform 3 and isoform 4. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK032060 mRNA. Translation: BAC27676.1.
AK036018 mRNA. No translation available.
AK044634 mRNA. Translation: BAC32012.1.
AK083111 mRNA. Translation: BAC38764.1.
AK083826 mRNA. Translation: BAE43385.1.
AK084070 mRNA. Translation: BAC39111.1.
AK166115 mRNA. Translation: BAE38580.1.
AC102480 Genomic DNA. No translation available.
AC102591 Genomic DNA. No translation available.
AC131744 Genomic DNA. No translation available.
BC043123 mRNA. Translation: AAH43123.1.
BC059251 mRNA. Translation: AAH59251.1.
CCDSiCCDS38625.1. [Q8C8R3-3]
RefSeq