Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myelin expression factor 2

Gene

Myef2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Transcriptional repressor of the myelin basic protein gene (MBP). Binds to the proximal MB1 element 5'-TTGTCC-3' of the MBP promoter. Its binding to MB1 and function are inhibited by PURA.3 Publications

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Transcription

Keywords - Ligandi

DNA-binding, RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Myelin expression factor 2
Short name:
MEF-2
Short name:
MyEF-2
Gene namesi
Name:Myef2
Synonyms:Kiaa1341, Mef2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componentsi: Chromosome 2, Chromosome 3

Organism-specific databases

MGIiMGI:104592. Myef2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000816561 – 591Myelin expression factor 2Add BLAST591

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei397Omega-N-methylarginineCombined sources1
Modified residuei417Omega-N-methylarginineCombined sources1
Modified residuei422PhosphoserineBy similarity1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

MaxQBiQ8C854.
PaxDbiQ8C854.
PeptideAtlasiQ8C854.
PRIDEiQ8C854.

PTM databases

iPTMnetiQ8C854.
PhosphoSitePlusiQ8C854.
SwissPalmiQ8C854.

Expressioni

Tissue specificityi

Highly expressed in the brain.1 Publication

Gene expression databases

BgeeiENSMUSG00000027201.
ExpressionAtlasiQ8C854. baseline and differential.
GenevisibleiQ8C854. MM.

Interactioni

Subunit structurei

Monomer.1 Publication

Protein-protein interaction databases

BioGridi201640. 4 interactors.
IntActiQ8C854. 5 interactors.
MINTiMINT-4118183.
STRINGi10090.ENSMUSP00000123088.

Structurei

3D structure databases

ProteinModelPortaliQ8C854.
SMRiQ8C854.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini91 – 169RRM 1PROSITE-ProRule annotationAdd BLAST79
Domaini224 – 301RRM 2PROSITE-ProRule annotationAdd BLAST78
Domaini514 – 590RRM 3PROSITE-ProRule annotationAdd BLAST77

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi321 – 513Gly-richAdd BLAST193

Sequence similaritiesi

Contains 3 RRM (RNA recognition motif) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IKNU. Eukaryota.
ENOG4110PAX. LUCA.
GeneTreeiENSGT00410000025635.
HOGENOMiHOG000231932.
HOVERGENiHBG054880.
InParanoidiQ8C854.
OMAiHEEYRSH.
OrthoDBiEOG091G0E2C.
PhylomeDBiQ8C854.
TreeFamiTF313406.

Family and domain databases

Gene3Di3.30.70.330. 3 hits.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF00076. RRM_1. 3 hits.
[Graphical view]
SMARTiSM00360. RRM. 3 hits.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 3 hits.
PROSITEiPS50102. RRM. 3 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8C854-4) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MADADKSEAA AGDDGSQQQP AEPRRDTHPG EPEKPPRSSA NGVKMENDES
60 70 80 90 100
VKEEKSDLKE KSTGNKKANR FHPYSKDKNS GTGEKKGPNR NRVFISNIPY
110 120 130 140 150
DMKWQAIKDL MREKVGEVTY VELFKDAEGK SRGCGVVEFK DEEFVKKALE
160 170 180 190 200
TMNKYDLSGR PLNIKEDPDG ENARRALQRT GTSFQGSHAS DVGSGLVNLP
210 220 230 240 250
PSILNNPNIP PEVISNLQAG RLGSTIFVAN LDFKVGWKKL KEVFSIAGTV
260 270 280 290 300
KRADIKEDKD GKSRGMGTVT FEQAIEAVQA ISMFNGQFLF DRPMHVKMDD
310 320 330 340 350
KSVPHEDYRS HDSKTSQLPR GLGGIGMGLG PGGQPISASQ LNITGVMGNL
360 370 380 390 400
GPSGMGMDGP GFGGVNRIGG GVGFGGLEAM NSMAGFGGVG RMGELYRGAM
410 420 430 440 450
TSSMERDFGR GDIGLSRGFG DSFGRLGSAM IGGFAGRIGA SNMGPVGTGI
460 470 480 490 500
SGSMSGMSTV TGGMGMGLDR MSSSFDRMGP GIGAILERSI DVDRGFLSGP
510 520 530 540 550
MGSGMRDRLG SKGNQIFVRN LPFDLTWQKL KEKFSQCGHV MFAEIKMENG
560 570 580 590
KSKGCGTVRF ESAESAEKAC RIMNGIKISG REIDVRLDRN A
Length:591
Mass (Da):63,295
Last modified:March 1, 2003 - v1
Checksum:i7F30703C519DB9A6
GO
Isoform 2 (identifier: Q8C854-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     354-370: Missing.

Show »
Length:574
Mass (Da):61,734
Checksum:iFC3A44B015C32E86
GO
Isoform 3 (identifier: Q8C854-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     427-451: GSAMIGGFAGRIGASNMGPVGTGIS → G
     511-512: SK → RN
     513-591: Missing.

Show »
Length:488
Mass (Da):52,213
Checksum:i797C87A2C49DF8CC
GO
Isoform 4 (identifier: Q8C854-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     394-451: ELYRGAMTSSMERDFGRGDIGLSRGFGDSFGRLGSAMIGGFAGRIGASNMGPVGTGIS → G
     539-555: HVMFAEIKMENGKSKGC → QINRDSKTHSNCGQHHS
     556-591: Missing.

Show »
Length:498
Mass (Da):53,544
Checksum:iEB086DAAA1D41429
GO

Sequence cautioni

The sequence AAH60946 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC98146 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti341L → R in AAA78270 (PubMed:7534248).Curated1
Sequence conflicti537C → L in AAA78270 (PubMed:7534248).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_013455354 – 370Missing in isoform 2. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_013456394 – 451ELYRG…GTGIS → G in isoform 4. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_013457427 – 451GSAMI…GTGIS → G in isoform 3. 1 PublicationAdd BLAST25
Alternative sequenceiVSP_013458511 – 512SK → RN in isoform 3. 1 Publication2
Alternative sequenceiVSP_013459513 – 591Missing in isoform 3. 1 PublicationAdd BLAST79
Alternative sequenceiVSP_013460539 – 555HVMFA…KSKGC → QINRDSKTHSNCGQHHS in isoform 4. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_013461556 – 591Missing in isoform 4. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK048404 mRNA. Translation: BAC33325.1.
AK129336 mRNA. Translation: BAC98146.1. Different initiation.
BC060946 mRNA. Translation: AAH60946.1. Different initiation.
AF483504 mRNA. Translation: AAL90778.1.
AF483505 mRNA. Translation: AAL90779.1.
U13262 mRNA. Translation: AAA78270.1.
CCDSiCCDS50690.1. [Q8C854-3]
CCDS50691.1. [Q8C854-4]
PIRiA56704.
RefSeqiNP_001155889.1. NM_001162417.1. [Q8C854-4]
XP_006498947.1. XM_006498884.3. [Q8C854-3]
XP_017171620.1. XM_017316131.1. [Q8C854-4]
XP_017171621.1. XM_017316132.1. [Q8C854-4]
XP_017171623.1. XM_017316134.1. [Q8C854-4]
UniGeneiMm.18535.
Mm.330538.
Mm.436860.
Mm.455632.

Genome annotation databases

EnsembliENSMUST00000061419; ENSMUSP00000058811; ENSMUSG00000049230. [Q8C854-2]
ENSMUST00000067780; ENSMUSP00000066312; ENSMUSG00000027201. [Q8C854-3]
ENSMUST00000110501; ENSMUSP00000106127; ENSMUSG00000027201. [Q8C854-3]
ENSMUST00000152367; ENSMUSP00000123088; ENSMUSG00000027201. [Q8C854-4]
GeneIDi17876.
KEGGimmu:17876.
UCSCiuc008mbw.2. mouse. [Q8C854-4]
uc008mby.2. mouse. [Q8C854-3]
uc012cdb.1. mouse. [Q8C854-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK048404 mRNA. Translation: BAC33325.1.
AK129336 mRNA. Translation: BAC98146.1. Different initiation.
BC060946 mRNA. Translation: AAH60946.1. Different initiation.
AF483504 mRNA. Translation: AAL90778.1.
AF483505 mRNA. Translation: AAL90779.1.
U13262 mRNA. Translation: AAA78270.1.
CCDSiCCDS50690.1. [Q8C854-3]
CCDS50691.1. [Q8C854-4]
PIRiA56704.
RefSeqiNP_001155889.1. NM_001162417.1. [Q8C854-4]
XP_006498947.1. XM_006498884.3. [Q8C854-3]
XP_017171620.1. XM_017316131.1. [Q8C854-4]
XP_017171621.1. XM_017316132.1. [Q8C854-4]
XP_017171623.1. XM_017316134.1. [Q8C854-4]
UniGeneiMm.18535.
Mm.330538.
Mm.436860.
Mm.455632.

3D structure databases

ProteinModelPortaliQ8C854.
SMRiQ8C854.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi201640. 4 interactors.
IntActiQ8C854. 5 interactors.
MINTiMINT-4118183.
STRINGi10090.ENSMUSP00000123088.

PTM databases

iPTMnetiQ8C854.
PhosphoSitePlusiQ8C854.
SwissPalmiQ8C854.

Proteomic databases

MaxQBiQ8C854.
PaxDbiQ8C854.
PeptideAtlasiQ8C854.
PRIDEiQ8C854.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000061419; ENSMUSP00000058811; ENSMUSG00000049230. [Q8C854-2]
ENSMUST00000067780; ENSMUSP00000066312; ENSMUSG00000027201. [Q8C854-3]
ENSMUST00000110501; ENSMUSP00000106127; ENSMUSG00000027201. [Q8C854-3]
ENSMUST00000152367; ENSMUSP00000123088; ENSMUSG00000027201. [Q8C854-4]
GeneIDi17876.
KEGGimmu:17876.
UCSCiuc008mbw.2. mouse. [Q8C854-4]
uc008mby.2. mouse. [Q8C854-3]
uc012cdb.1. mouse. [Q8C854-2]

Organism-specific databases

CTDi50804.
MGIiMGI:104592. Myef2.
RougeiSearch...

Phylogenomic databases

eggNOGiENOG410IKNU. Eukaryota.
ENOG4110PAX. LUCA.
GeneTreeiENSGT00410000025635.
HOGENOMiHOG000231932.
HOVERGENiHBG054880.
InParanoidiQ8C854.
OMAiHEEYRSH.
OrthoDBiEOG091G0E2C.
PhylomeDBiQ8C854.
TreeFamiTF313406.

Miscellaneous databases

PROiQ8C854.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000027201.
ExpressionAtlasiQ8C854. baseline and differential.
GenevisibleiQ8C854. MM.

Family and domain databases

Gene3Di3.30.70.330. 3 hits.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF00076. RRM_1. 3 hits.
[Graphical view]
SMARTiSM00360. RRM. 3 hits.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 3 hits.
PROSITEiPS50102. RRM. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMYEF2_MOUSE
AccessioniPrimary (citable) accession number: Q8C854
Secondary accession number(s): Q60690
, Q6P930, Q6ZPT3, Q8QZZ1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 26, 2005
Last sequence update: March 1, 2003
Last modified: November 2, 2016
This is version 116 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.