Q8C7W7 (DCR1B_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 72.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 5' exonuclease Apollo EC=3.1.-.- Alternative name(s): DNA cross-link repair 1B protein SNM1 homolog B | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 541 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | 5'-3' exonuclease that plays a central role in telomere maintenance and protection during S-phase. Participates in the protection of telomeres against non-homologous end-joining (NHEJ)-mediated repair, thereby ensuring that telomeres do not fuse. Plays a key role in telomeric loop (T loop) formation by being recruited by TERF2 at the leading end telomeres and by processing leading-end telomeres immediately after their replication via its exonuclease activity: generates 3' single-stranded overhang at the leading end telomeres avoiding blunt leading-end telomeres that are vulnerable to end-joining reactions and expose the telomere end in a manner that activates the DNA repair pathways. Together with TERF2, required to protect telomeres from replicative damage during replication by controlling the amount of DNA topoisomerase (TOP1, TOP2A and TOP2B) needed for telomere replication during fork passage and prevent aberrant telomere topology. Also involved in response to DNA damage: plays a role in response to DNA interstrand cross-links (ICLs) by facilitating double-strand break formation. In case of spindle stress, involved in prophase checkpoint. Ref.4 Ref.5 |
| Subunit structure | Interacts with MUS81, MRE11 and FANCD2. Interacts with HSPA2, HSPA8 and HSPA14. Interacts with SPAG5 By similarity. Interacts with TERF2; the interaction is direct. Ref.5 |
| Subcellular location | Chromosome › telomere. Nucleus By similarity. Cytoplasm › cytoskeleton › centrosome By similarity. Note: Mainly localizes to telomeres, recruited via its interaction with TERF2. During mitosis, localizes to the centrosome. Ref.4 Ref.5 |
| Domain | The TBM domain mediates interaction with TERF2 By similarity. |
| Post-translational modification | Ubiquitinated, leading to its degradation. Interaction with TERF2 protects it from ubiquitination By similarity. |
| Disruption phenotype | Embryos are smaller than wild-type embryos and neonates die at postnatal day 0 (P0). Cells activate the ATM kinase at their telomeres in S phase and show leading-end telomere fusions which are accompanied by a reduction in the telomeric overhang signal. Ref.4 Ref.5 |
| Sequence similarities | Belongs to the DNA repair metallo-beta-lactamase (DRMBL) family. |
| Sequence caution | The sequence AAH11094.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAC39165.1 differs from that shown. Reason: Frameshift at position 55. The sequence BAE23379.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8C7W7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8C7W7-2) The sequence of this isoform differs from the canonical sequence as follows: 1-126: Missing. | ||||||
| Isoform 3 (identifier: Q8C7W7-3) The sequence of this isoform differs from the canonical sequence as follows: 181-213: LYSLGKESLLEQLALEFRTWVVLSPQRLELVQL → ERFPFFFHSCLVNQNSLKVLIVFQIFVPCSPFL 214-541: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 541 | 541 | 5' exonuclease Apollo | PRO_0000209120 | |||||
Regions | |||||||||
| Motif | 492 – 507 | 16 | TBM | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 126 | 126 | Missing in isoform 2. | VSP_015174 | |||||
| Alternative sequence | 181 – 213 | 33 | LYSLG…ELVQL → ERFPFFFHSCLVNQNSLKVL IVFQIFVPCSPFL in isoform 3. | VSP_015175 | |||||
| Alternative sequence | 214 – 541 | 328 | Missing in isoform 3. | VSP_015176 | |||||
Experimental info | |||||||||
| Mutagenesis | 14 | 1 | D → A: Abolishes exonuclease activity without affecting the telomere localization, leading to impaired 3'-overhang at the leading end telomeres. Ref.4 | ||||||
| Mutagenesis | 31 – 35 | 5 | HMHCD → AMACN: Abolishes exonuclease activity, leading to activate the ATM signaling pathway; when associated with A-230. Ref.5 | ||||||
| Mutagenesis | 230 | 1 | H → A: Abolishes exonuclease activity, leading to activate the ATM signaling pathway; when associated with 31-A--N-35. Ref.5 | ||||||
| Mutagenesis | 500 – 504 | 5 | Missing: Abolishes interaction with TERF2 and localization to telomeres, leading to activate the ATM signaling pathway. Ref.5 | ||||||
| Sequence conflict | 49 | 1 | Y → D in BAE23379. Ref.1 | ||||||
| Sequence conflict | 162 | 1 | T → S in BAC33550. Ref.1 | ||||||
| Sequence conflict | 327 | 1 | Y → H in AAI25278. Ref.3 | ||||||
| Sequence conflict | 412 | 1 | P → L in AAI25278. Ref.3 | ||||||
| Sequence conflict | 540 | 1 | V → D in BAE23700. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). Strain: C57BL/6J and NOD. Tissue: Adipose tissue, Bone, Eye, Spinal cord and Testis. |
| [2] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 82-541 (ISOFORM 1). Strain: Czech II. Tissue: Brain and Mammary gland. |
| [4] | "SNMIB/Apollo protects leading-strand telomeres against NHEJ-mediated repair." Lam Y.C., Akhter S., Gu P., Ye J., Poulet A., Giraud-Panis M.J., Bailey S.M., Gilson E., Legerski R.J., Chang S. EMBO J. 29:2230-2241(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, DISRUPTION PHENOTYPE, MUTAGENESIS OF ASP-14. |
| [5] | "Apollo contributes to G overhang maintenance and protects leading-end telomeres." Wu P., van Overbeek M., Rooney S., de Lange T. Mol. Cell 39:606-617(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH TERF2, DISRUPTION PHENOTYPE, MUTAGENESIS OF 31-HIS--ASP-35; HIS-230 AND 500-TYR--PRO-504. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK046571 mRNA. Translation: BAC32791.1. AK049115 mRNA. Translation: BAC33550.1. AK084347 mRNA. Translation: BAC39165.1. Frameshift. AK134324 mRNA. Translation: BAE22098.1. AK137495 mRNA. Translation: BAE23379.1. Different initiation. AK138568 mRNA. Translation: BAE23700.1. AK154124 mRNA. Translation: BAE32389.1. CU210953 Genomic DNA. Translation: CAQ12168.1. CU210953 Genomic DNA. Translation: CAQ12169.1. BC011094 mRNA. Translation: AAH11094.1. Different initiation. BC067017 mRNA. Translation: AAH67017.1. BC125277 mRNA. Translation: AAI25278.1. |
| IPI | IPI00226917. IPI00403798. IPI00458408. |
| RefSeq | NP_001020483.1. NM_001025312.1. NP_598626.2. NM_133865.2. |
| UniGene | Mm.374850. |
3D structure databases | |
| ProteinModelPortal | Q8C7W7. |
| SMR | Q8C7W7. Positions 6-299. |
| ModBase | Search... |
Proteomic databases | |
| PRIDE | Q8C7W7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000029435; ENSMUSP00000029435; ENSMUSG00000027845. ENSMUST00000063502; ENSMUSP00000067695; ENSMUSG00000027845. ENSMUST00000106832; ENSMUSP00000102445; ENSMUSG00000027845. ENSMUST00000106834; ENSMUSP00000102447; ENSMUSG00000027845. |
| GeneID | 140917. |
| KEGG | mmu:140917. |
| UCSC | uc008qtl.1. mouse. uc008qtm.1. mouse. uc008qto.1. mouse. |
Organism-specific databases | |
| CTD | 64858. |
| MGI | MGI:2156057. Dclre1b. |
Phylogenomic databases | |
| eggNOG | COG1236. |
| GeneTree | ENSGT00530000063183. |
| HOVERGEN | HBG081420. |
| InParanoid | B0V3P0. |
| KO | K15341. |
| OMA | KYLLTPV. |
| OrthoDB | EOG43R3N5. |
Gene expression databases | |
| ArrayExpress | Q8C7W7. |
| Bgee | Q8C7W7. |
| Genevestigator | Q8C7W7. |
| GermOnline | ENSMUSG00000027845. Mus musculus. |
Family and domain databases | |
| InterPro | IPR001279. Beta-lactamas-like. IPR011084. DRMBL. [Graphical view] |
| Pfam | PF07522. DRMBL. 1 hit. [Graphical view] |
| SMART | SM00849. Lactamase_B. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 370035. |
| SOURCE | Search... |
Entry information
| Entry name | DCR1B_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8C7W7 Secondary accession number(s): A0JLW2 Q921S0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
