Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RNA-binding protein 4

Gene

Rbm4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

RNA-binding factor involved in multiple aspects of cellular processes like alternative splicing of pre-mRNA and translation regulation. Modulates alternative 5'-splice site and exon selection. Acts as a muscle cell differentiation-promoting factor. Activates exon skipping of the PTB pre-mRNA during muscle cell differentiation. Antagonizes the activity of the splicing factor PTBP1 to modulate muscle cell-specific exon selection of alpha tropomyosin. Binds to intronic pyrimidine-rich sequence of the TPM1 and MAPT pre-mRNAs. Required for the translational activation of PER1 mRNA in response to circadian clock. Binds directly to the 3'-UTR of the PER1 mRNA. Exerts a suppressive activity on Cap-dependent translation via binding to CU-rich responsive elements within the 3'UTR of mRNAs, a process increased under stress conditions or during myocytes differentiation. Recruits EIF4A1 to stimulate IRES-dependent translation initiation in respons to cellular stress. Associates to internal ribosome entry segment (IRES) in target mRNA species under stress conditions. Plays a role for miRNA-guided RNA cleavage and translation suppression by promoting association of AGO2-containing miRNPs with their cognate target mRNAs. Associates with miRNAs during muscle cell differentiation. Binds preferentially to 5'-CGCGCG[GCA]-3' motif in vitro.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri160 – 177CCHC-typeAdd BLAST18

GO - Molecular functioni

GO - Biological processi

  • cap-independent translational initiation Source: UniProtKB
  • circadian regulation of gene expression Source: MGI
  • circadian regulation of translation Source: UniProtKB
  • enteroendocrine cell differentiation Source: MGI
  • entrainment of circadian clock by photoperiod Source: UniProtKB
  • glucose homeostasis Source: MGI
  • insulin secretion involved in cellular response to glucose stimulus Source: MGI
  • IRES-dependent translational initiation of linear mRNA Source: UniProtKB
  • miRNA mediated inhibition of translation Source: UniProtKB
  • mRNA processing Source: UniProtKB-KW
  • negative regulation of translation Source: UniProtKB
  • negative regulation of translational initiation Source: UniProtKB
  • negative regulation of translation in response to stress Source: UniProtKB
  • pancreas development Source: MGI
  • positive regulation of muscle cell differentiation Source: UniProtKB
  • positive regulation of translation Source: MGI
  • regulation of alternative mRNA splicing, via spliceosome Source: MGI
  • regulation of gene expression Source: MGI
  • regulation of insulin receptor signaling pathway Source: MGI
  • regulation of nucleocytoplasmic transport Source: UniProtKB
  • response to arsenic-containing substance Source: UniProtKB
  • RNA splicing Source: UniProtKB-KW

Keywordsi

Molecular functionActivator, RNA-binding
Biological processDifferentiation, mRNA processing, mRNA splicing, RNA-mediated gene silencing
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
RNA-binding protein 4
Alternative name(s):
Lark homolog
Short name:
mLark
RNA-binding motif protein 4
RNA-binding motif protein 4a
Gene namesi
Name:Rbm4
Synonyms:Rbm4a
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 19

Organism-specific databases

MGIiMGI:1100865. Rbm4.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000817551 – 361RNA-binding protein 4Add BLAST361

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki79Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei86PhosphoserineBy similarity1
Modified residuei306PhosphoserineBy similarity1

Post-translational modificationi

Phosphorylated. Phosphorylated in vitro on Ser-306 by SRPK1. Phosphorylation on Ser-306 is induced upon cell stress signaling, which alters its subcellular localization and may modulate its activity on IRES-mediated mRNA translation (By similarity). Phosphorylated. Phosphorylation on Ser-306 is induced upon cell muscle differentiation.By similarity1 Publication

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ8C7Q4.
PaxDbiQ8C7Q4.
PRIDEiQ8C7Q4.

PTM databases

iPTMnetiQ8C7Q4.
PhosphoSitePlusiQ8C7Q4.

Expressioni

Tissue specificityi

Expressed in the suprachiasmatic nucleus (SCN). Expressed in myocytes; expression gradually increases during muscle cell differentiation (at protein level). Expressed in the suprachiasmatic nucleus (SCN).3 Publications

Inductioni

Accumulates according to a circadian rhythm in the SCN.1 Publication

Gene expression databases

BgeeiENSMUSG00000094936.
CleanExiMM_RBM4.
ExpressionAtlasiQ8C7Q4. baseline and differential.
GenevisibleiQ8C7Q4. MM.

Interactioni

Subunit structurei

Interacts with TNPO3; the interaction mediates nuclear import of the protein and is disrupted by nuclear Ran bound to GTP. Interacts with EIF4G1 and WT1. Interacts with EIF4A1; the interaction is modulated under stress-induced conditions. Interacts with AGO1. Interacts with AGO2; the interaction occurs under both cell proliferation and differentiation conditions and in an RNA- and phosphorylation-independent manner. Interacts with DDX5; the interaction occurs in an RNA-independent manner (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi202822. 1 interactor.
207870. 5 interactors.
IntActiQ8C7Q4. 1 interactor.
STRINGi10090.ENSMUSP00000137345.

Structurei

3D structure databases

ProteinModelPortaliQ8C7Q4.
SMRiQ8C7Q4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini2 – 72RRM 1Add BLAST71
Domaini78 – 148RRM 2Add BLAST71

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni196 – 361Interaction with TNPO3By similarityAdd BLAST166

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi233 – 241Poly-Ala9
Compositional biasi283 – 292Poly-Ala10

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri160 – 177CCHC-typeAdd BLAST18

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiENOG410IQW2. Eukaryota.
ENOG41105PP. LUCA.
GeneTreeiENSGT00390000020883.
HOGENOMiHOG000026790.
HOVERGENiHBG062217.
InParanoidiQ8C7Q4.
KOiK13187.
OrthoDBiEOG091G08PZ.
TreeFamiTF320661.

Family and domain databases

CDDicd12606. RRM1_RBM4. 1 hit.
cd12607. RRM2_RBM4. 1 hit.
Gene3Di4.10.60.10. 1 hit.
InterProiView protein in InterPro
IPR035979. RBD_domain_sf.
IPR034897. RBM4_RRM1.
IPR034898. RBM4_RRM2.
IPR000504. RRM_dom.
IPR001878. Znf_CCHC.
IPR036875. Znf_CCHC_sf.
PfamiView protein in Pfam
PF00076. RRM_1. 2 hits.
PF00098. zf-CCHC. 1 hit.
SMARTiView protein in SMART
SM00360. RRM. 2 hits.
SM00343. ZnF_C2HC. 1 hit.
SUPFAMiSSF54928. SSF54928. 2 hits.
PROSITEiView protein in PROSITE
PS50102. RRM. 2 hits.
PS50158. ZF_CCHC. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8C7Q4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVKLFIGNLP REATEQEIRS LFEQYGKVLE CDIIKNYGFV HIEDKTAAED
60 70 80 90 100
AIRNLHHYKL HGVNINVEAS KNKSKASTKL HVGNISPTCT NQELRAKFEE
110 120 130 140 150
YGPVIECDIV KDYAFVHMER AEDAVEAIRG LDNTEFQGKR MHVQLSTSRL
160 170 180 190 200
RTAPGMGDQS GCYRCGKEGH WSKECPIDRS GRVADLTEQY NEQYGAVRTP
210 220 230 240 250
YTMSYGDSLY YNNTYGALDA YYKRCRAARS YEAVAAAAAS AYSNYAEQTL
260 270 280 290 300
SQLPQVQNTA MASHLTSTSL DPYNRHLLPP SGAAAAAAAA AACTAASTSY
310 320 330 340 350
YGRDRSPLRR ATGPVLTVGE GYGYGHDSEL SQASAAARNS LYDMARYERE
360
QYADRARYSA F
Length:361
Mass (Da):40,046
Last modified:March 1, 2003 - v1
Checksum:iD50BB51553AFA4E0
GO
Isoform 2 (identifier: Q8C7Q4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     139-168: KRMHVQLSTSRLRTAPGMGDQSGCYRCGKE → ESLFWSAQYKAVRNELVEKRKALGWKDFAG
     169-361: Missing.

Note: May be due to an intron retention. No experimental confirmation available.
Show »
Length:168
Mass (Da):19,206
Checksum:i5E2CD35CB4E4FEFB
GO

Sequence cautioni

The sequence AAC53171 differs from that shown. Reason: Frameshift at position 239.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti243S → N in AAC53171 (PubMed:9169144).Curated1
Sequence conflicti292A → AAAAA in AAC53171 (PubMed:9169144).Curated1
Sequence conflicti299S → P in AAC53171 (PubMed:9169144).Curated1
Sequence conflicti316L → P in AAC53171 (PubMed:9169144).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_013417139 – 168KRMHV…RCGKE → ESLFWSAQYKAVRNELVEKR KALGWKDFAG in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_013418169 – 361Missing in isoform 2. 1 PublicationAdd BLAST193

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U89506 mRNA. Translation: AAC53171.1. Frameshift.
AK049659 mRNA. Translation: BAC33862.1.
AK087488 mRNA. Translation: BAC39895.1.
CCDSiCCDS29436.1. [Q8C7Q4-1]
RefSeqiNP_001277051.1. NM_001290122.1. [Q8C7Q4-1]
NP_001277052.1. NM_001290123.1. [Q8C7Q4-1]
NP_001277053.1. NM_001290124.1.
NP_001277054.1. NM_001290125.1.
NP_033058.2. NM_009032.3. [Q8C7Q4-1]
UniGeneiMm.426069.

Genome annotation databases

EnsembliENSMUST00000180248; ENSMUSP00000137345; ENSMUSG00000094936. [Q8C7Q4-1]
GeneIDi19653.
KEGGimmu:19653.
UCSCiuc008gau.1. mouse. [Q8C7Q4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiRBM4_MOUSE
AccessioniPrimary (citable) accession number: Q8C7Q4
Secondary accession number(s): O08752, Q8BN66
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 12, 2005
Last sequence update: March 1, 2003
Last modified: November 22, 2017
This is version 128 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot