Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8C7M3

- TRIM9_MOUSE

UniProt

Q8C7M3 - TRIM9_MOUSE

Protein

E3 ubiquitin-protein ligase TRIM9

Gene

Trim9

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 118 (01 Oct 2014)
      Sequence version 2 (04 Aug 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    E3 ubiquitin-protein ligase which ubiquitinates itself in cooperation with an E2 enzyme UBE2D2/UBC4 and serves as a targeting signal for proteasomal degradation. May play a role in regulation of neuronal functions. May act as a regulator of synaptic vesicle exocytosis by controlling the availability of SNAP25 for the SNARE complex formation By similarity.By similarity

    Pathwayi

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri10 – 5041RING-typePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri163 – 21250B box-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri224 – 26643B box-type 2PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. ligase activity Source: UniProtKB-KW
    2. ubiquitin-protein transferase activity Source: UniProtKB
    3. zinc ion binding Source: InterPro

    GO - Biological processi

    1. proteasome-mediated ubiquitin-dependent protein catabolic process Source: UniProtKB

    Keywords - Molecular functioni

    Ligase

    Keywords - Biological processi

    Ubl conjugation pathway

    Keywords - Ligandi

    Metal-binding, Zinc

    Enzyme and pathway databases

    ReactomeiREACT_199115. Antigen processing: Ubiquitination & Proteasome degradation.
    UniPathwayiUPA00143.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    E3 ubiquitin-protein ligase TRIM9 (EC:6.3.2.-)
    Alternative name(s):
    Tripartite motif-containing protein 9
    Gene namesi
    Name:Trim9
    Synonyms:Kiaa0282
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 12

    Organism-specific databases

    MGIiMGI:2137354. Trim9.

    Subcellular locationi

    Cytoplasm 1 Publication. Cell projectiondendrite 1 Publication. Cytoplasmic vesiclesecretory vesiclesynaptic vesicle By similarity. Cell junctionsynapse By similarity. Cytoplasmcytoskeleton By similarity
    Note: Enriched at synaptic terminals where it exists in a soluble form and a synaptic vesicle-associated form. Associated with the cytoskeleton By similarity. Found in proximal dendrites of pyramidal neurons in the cerebral cortex and hippocampus, and Purkinje cells in the cerebellum.By similarity

    GO - Cellular componenti

    1. cell junction Source: UniProtKB-KW
    2. cytoplasm Source: UniProtKB
    3. cytoskeleton Source: UniProtKB-SubCell
    4. dendrite Source: UniProtKB
    5. synaptic vesicle Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell junction, Cell projection, Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Synapse

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 817817E3 ubiquitin-protein ligase TRIM9PRO_0000056209Add
    BLAST

    Post-translational modificationi

    Auto-ubiquitinated.By similarity

    Keywords - PTMi

    Ubl conjugation

    Proteomic databases

    MaxQBiQ8C7M3.
    PaxDbiQ8C7M3.
    PRIDEiQ8C7M3.

    PTM databases

    PhosphoSiteiQ8C7M3.

    Expressioni

    Tissue specificityi

    Brain. Expression is higher in the cerebral cortex and hippocampus (at protein level). Its expression is mainly confined to the central nervous system. The developing neocortex, the dorsal thalamus, the midbrain, the basal area of the hindbrain and spinal cord show high level of expression during embryogenesis. In adult brain, it is detected in the Purkinje cells of the cerebellum, in the hippocampus, and in the cortex.2 Publications

    Developmental stagei

    First seen at E9.5. From E9.5 to E11.5, it remains uniformly present in the ventral part of the entire neuroepithelium and in the dorsal root ganglia. A more restricted central nervous system (CNS) expression is observed at E13.5 and E15.5 when it is present in specific regions of the forebrain, midbrain, hindbrain and spinal cord.1 Publication

    Gene expression databases

    ArrayExpressiQ8C7M3.
    BgeeiQ8C7M3.
    CleanExiMM_TRIM9.
    GenevestigatoriQ8C7M3.

    Interactioni

    Subunit structurei

    Interacts with SNAP25.By similarity

    Protein-protein interaction databases

    BioGridi220445. 1 interaction.
    IntActiQ8C7M3. 1 interaction.
    MINTiMINT-4138599.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8C7M3.
    SMRiQ8C7M3. Positions 3-39, 163-266, 319-377, 436-537.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini374 – 43259COSPROSITE-ProRule annotationAdd
    BLAST
    Domaini440 – 53596Fibronectin type-IIIPROSITE-ProRule annotationAdd
    BLAST
    Domaini613 – 794182B30.2/SPRYPROSITE-ProRule annotationAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili273 – 34068Sequence AnalysisAdd
    BLAST

    Domaini

    The coiled coil domain mediates the interaction with the N-terminal t-SNARE domain of SNAP25.By similarity

    Sequence similaritiesi

    Belongs to the TRIM/RBCC family.Curated
    Contains 2 B box-type zinc fingers.PROSITE-ProRule annotation
    Contains 1 B30.2/SPRY domain.PROSITE-ProRule annotation
    Contains 1 COS domain.PROSITE-ProRule annotation
    Contains 1 fibronectin type-III domain.PROSITE-ProRule annotation
    Contains 1 RING-type zinc finger.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri10 – 5041RING-typePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri163 – 21250B box-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri224 – 26643B box-type 2PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Coiled coil, Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG260378.
    GeneTreeiENSGT00740000114914.
    HOVERGENiHBG062305.
    InParanoidiQ8C7M3.
    KOiK10649.
    PhylomeDBiQ8C7M3.

    Family and domain databases

    Gene3Di2.60.40.10. 1 hit.
    3.30.40.10. 2 hits.
    4.10.45.10. 1 hit.
    InterProiIPR001870. B30.2/SPRY.
    IPR003649. Bbox_C.
    IPR008985. ConA-like_lec_gl_sf.
    IPR017903. COS_domain.
    IPR003961. Fibronectin_type3.
    IPR013783. Ig-like_fold.
    IPR003877. SPRY_rcpt.
    IPR000315. Znf_B-box.
    IPR018957. Znf_C3HC4_RING-type.
    IPR001841. Znf_RING.
    IPR013083. Znf_RING/FYVE/PHD.
    IPR017907. Znf_RING_CS.
    [Graphical view]
    PfamiPF00041. fn3. 1 hit.
    PF00622. SPRY. 1 hit.
    PF00643. zf-B_box. 1 hit.
    PF00097. zf-C3HC4. 1 hit.
    [Graphical view]
    SMARTiSM00502. BBC. 1 hit.
    SM00336. BBOX. 2 hits.
    SM00060. FN3. 1 hit.
    SM00184. RING. 1 hit.
    [Graphical view]
    SUPFAMiSSF49265. SSF49265. 1 hit.
    SSF49899. SSF49899. 1 hit.
    PROSITEiPS50188. B302_SPRY. 1 hit.
    PS51262. COS. 1 hit.
    PS50853. FN3. 1 hit.
    PS50119. ZF_BBOX. 2 hits.
    PS00518. ZF_RING_1. 1 hit.
    PS50089. ZF_RING_2. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8C7M3-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEEMEEELKC PVCGSFYREP IILPCSHNLC QACARNILVQ TPESESPQSR    50
    RASGSGVSDY DYLDLDKMSL YSEADSGYGS YGGFASAPTT PCQKSPNGVR 100
    VFPPAMPPPP THLSPALAPV PRNSCITCPQ CHRSLILDDR GLRGFPKNRV 150
    LEGVIDRYQQ SKAAALKCQL CEKAPKEATV MCEQCDVFYC DPCRLRCHPP 200
    RGPLAKHRLV PPAQGRVSRR LSPRKVSTCT DHELENHSMY CVQCKMPVCY 250
    QCLEEGKHSS HEVKALGAMW KLHKSQLSQA LNGLSDRAKE AKEFLVQLRT 300
    MVQQIQENSV EFEACLVAQC DALIDALNRR KAQLLARVNK EHEHKLKVVR 350
    DQISHCTVKL RQTTGLMEYC LEVIKENDPS GFLQISDALI RRVHLTEDQW 400
    GKGTLTPRMT TDFDLSLDNS PLLQSIHQLD FVQVKASSPV PATPILQLEE 450
    CCTHNNSATL SWKQPPLSTV AADGYILELD DGSGGQFREV YVGKETMCTV 500
    DGLHFNSTYN ARVKAFNKTG VSPYSKTLVL QTSEAAGAHE TKPMKDTDSE 550
    EQTLPFPVPS ERLPLRRMSP FSSTLNLQPS FPGRSYFDFR SSPHQLSLHS 600
    SLQSLNAPGC NFETQSASYS QLVDIKKLLA VAWFAFDPGS AHSDIIFSND 650
    NLTVTCSSYD DRVVLGKTGF SKGVHYWELT IDRYDNHPDP AFGVARIDVM 700
    KDMMLGKDDK AWAMYVDNNR SWFMHNNSHT NRTEGGITKG ATIGVLLDLN 750
    RKTLTFFVNN EQQGPIAFEN VEGLFFPAVS LNRNVQVSLW APGLRACSGC 800
    YFKVCPGAVK SPQAPAP 817

    Note: May be due to an intron retention.

    Length:817
    Mass (Da):90,870
    Last modified:August 4, 2003 - v2
    Checksum:iF23A355F6FF5762D
    GO
    Isoform 2 (identifier: Q8C7M3-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         535-535: Missing.
         714-732: MYVDNNRSWFMHNNSHTNR → I

    Note: May be due to a competing acceptor splice site and to an exon skipping.

    Show »
    Length:798
    Mass (Da):88,507
    Checksum:iF078FC75904D43DC
    GO
    Isoform 3 (identifier: Q8C7M3-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         535-608: Missing.
         714-732: MYVDNNRSWFMHNNSHTNR → I
         788-817: SLWAPGLRACSGCYFKVCPGAVKSPQAPAP → TLHTGLPVPDFYSSRASIA

    Note: May be due to a competing donnor splice site and ?.

    Show »
    Length:714
    Mass (Da):79,311
    Checksum:i5395B4EDC3465ADD
    GO
    Isoform 4 (identifier: Q8C7M3-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         546-565: DTDSEEQTLPFPVPSERLPL → GMCGWRQSILRLLGIVLLVD
         566-817: Missing.

    Note: May be due to an intron retention.

    Show »
    Length:565
    Mass (Da):62,861
    Checksum:i0F105433DEBFC20A
    GO
    Isoform 5 (identifier: Q8C7M3-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         535-630: Missing.

    Note: May be due to exon skipping.

    Show »
    Length:721
    Mass (Da):80,236
    Checksum:i291E76ECE8DAAA5E
    GO
    Isoform 6 (identifier: Q8C7M3-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         535-536: AA → GR
         537-817: Missing.

    Note: May be due to an exon inclusion.

    Show »
    Length:536
    Mass (Da):59,727
    Checksum:i32EBC120E3D71B91
    GO

    Sequence cautioni

    The sequence BAC97919.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti27 – 271H → D in BAC28552. (PubMed:16141072)Curated
    Sequence conflicti251 – 2511Q → H in BAC33982. (PubMed:16141072)Curated
    Sequence conflicti254 – 2541E → Q in BAC33982. (PubMed:16141072)Curated
    Sequence conflicti319 – 3191Q → R in AAG53493. (PubMed:11331580)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei535 – 63096Missing in isoform 5. 1 PublicationVSP_007932Add
    BLAST
    Alternative sequencei535 – 60874Missing in isoform 3. 2 PublicationsVSP_007931Add
    BLAST
    Alternative sequencei535 – 5362AA → GR in isoform 6. 1 PublicationVSP_007933
    Alternative sequencei535 – 5351Missing in isoform 2. 1 PublicationVSP_007930
    Alternative sequencei537 – 817281Missing in isoform 6. 1 PublicationVSP_007934Add
    BLAST
    Alternative sequencei546 – 56520DTDSE…ERLPL → GMCGWRQSILRLLGIVLLVD in isoform 4. 1 PublicationVSP_007937Add
    BLAST
    Alternative sequencei566 – 817252Missing in isoform 4. 1 PublicationVSP_007938Add
    BLAST
    Alternative sequencei714 – 73219MYVDN…SHTNR → I in isoform 2 and isoform 3. 2 PublicationsVSP_007935Add
    BLAST
    Alternative sequencei788 – 81730SLWAP…QAPAP → TLHTGLPVPDFYSSRASIA in isoform 3. 2 PublicationsVSP_007936Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK049907 mRNA. Translation: BAC33982.1.
    AK034029 mRNA. Translation: BAC28552.1.
    AK028280 mRNA. Translation: BAC25854.1.
    AK048875 mRNA. Translation: BAC33479.1.
    AK129109 mRNA. Translation: BAC97919.1. Different initiation.
    BC052034 mRNA. Translation: AAH52034.1.
    AF220039 mRNA. Translation: AAG53493.1.
    CCDSiCCDS49077.1. [Q8C7M3-3]
    RefSeqiNP_001103672.1. NM_001110202.1. [Q8C7M3-3]
    NP_001103673.1. NM_001110203.1.
    NP_001273315.1. NM_001286386.1. [Q8C7M3-6]
    NP_001273316.1. NM_001286387.1.
    NP_001273317.1. NM_001286388.1.
    NP_444397.2. NM_053167.3.
    XP_006516471.1. XM_006516408.1. [Q8C7M3-4]
    UniGeneiMm.184012.

    Genome annotation databases

    EnsembliENSMUST00000110520; ENSMUSP00000106149; ENSMUSG00000021071. [Q8C7M3-3]
    GeneIDi94090.
    KEGGimmu:94090.
    UCSCiuc007ntp.3. mouse. [Q8C7M3-1]
    uc007nts.2. mouse. [Q8C7M3-2]
    uc011ynj.2. mouse. [Q8C7M3-3]
    uc011ynl.1. mouse. [Q8C7M3-6]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK049907 mRNA. Translation: BAC33982.1 .
    AK034029 mRNA. Translation: BAC28552.1 .
    AK028280 mRNA. Translation: BAC25854.1 .
    AK048875 mRNA. Translation: BAC33479.1 .
    AK129109 mRNA. Translation: BAC97919.1 . Different initiation.
    BC052034 mRNA. Translation: AAH52034.1 .
    AF220039 mRNA. Translation: AAG53493.1 .
    CCDSi CCDS49077.1. [Q8C7M3-3 ]
    RefSeqi NP_001103672.1. NM_001110202.1. [Q8C7M3-3 ]
    NP_001103673.1. NM_001110203.1.
    NP_001273315.1. NM_001286386.1. [Q8C7M3-6 ]
    NP_001273316.1. NM_001286387.1.
    NP_001273317.1. NM_001286388.1.
    NP_444397.2. NM_053167.3.
    XP_006516471.1. XM_006516408.1. [Q8C7M3-4 ]
    UniGenei Mm.184012.

    3D structure databases

    ProteinModelPortali Q8C7M3.
    SMRi Q8C7M3. Positions 3-39, 163-266, 319-377, 436-537.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 220445. 1 interaction.
    IntActi Q8C7M3. 1 interaction.
    MINTi MINT-4138599.

    PTM databases

    PhosphoSitei Q8C7M3.

    Proteomic databases

    MaxQBi Q8C7M3.
    PaxDbi Q8C7M3.
    PRIDEi Q8C7M3.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000110520 ; ENSMUSP00000106149 ; ENSMUSG00000021071 . [Q8C7M3-3 ]
    GeneIDi 94090.
    KEGGi mmu:94090.
    UCSCi uc007ntp.3. mouse. [Q8C7M3-1 ]
    uc007nts.2. mouse. [Q8C7M3-2 ]
    uc011ynj.2. mouse. [Q8C7M3-3 ]
    uc011ynl.1. mouse. [Q8C7M3-6 ]

    Organism-specific databases

    CTDi 114088.
    MGIi MGI:2137354. Trim9.
    Rougei Search...

    Phylogenomic databases

    eggNOGi NOG260378.
    GeneTreei ENSGT00740000114914.
    HOVERGENi HBG062305.
    InParanoidi Q8C7M3.
    KOi K10649.
    PhylomeDBi Q8C7M3.

    Enzyme and pathway databases

    UniPathwayi UPA00143 .
    Reactomei REACT_199115. Antigen processing: Ubiquitination & Proteasome degradation.

    Miscellaneous databases

    ChiTaRSi TRIM9. mouse.
    NextBioi 352073.
    PROi Q8C7M3.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8C7M3.
    Bgeei Q8C7M3.
    CleanExi MM_TRIM9.
    Genevestigatori Q8C7M3.

    Family and domain databases

    Gene3Di 2.60.40.10. 1 hit.
    3.30.40.10. 2 hits.
    4.10.45.10. 1 hit.
    InterProi IPR001870. B30.2/SPRY.
    IPR003649. Bbox_C.
    IPR008985. ConA-like_lec_gl_sf.
    IPR017903. COS_domain.
    IPR003961. Fibronectin_type3.
    IPR013783. Ig-like_fold.
    IPR003877. SPRY_rcpt.
    IPR000315. Znf_B-box.
    IPR018957. Znf_C3HC4_RING-type.
    IPR001841. Znf_RING.
    IPR013083. Znf_RING/FYVE/PHD.
    IPR017907. Znf_RING_CS.
    [Graphical view ]
    Pfami PF00041. fn3. 1 hit.
    PF00622. SPRY. 1 hit.
    PF00643. zf-B_box. 1 hit.
    PF00097. zf-C3HC4. 1 hit.
    [Graphical view ]
    SMARTi SM00502. BBC. 1 hit.
    SM00336. BBOX. 2 hits.
    SM00060. FN3. 1 hit.
    SM00184. RING. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49265. SSF49265. 1 hit.
    SSF49899. SSF49899. 1 hit.
    PROSITEi PS50188. B302_SPRY. 1 hit.
    PS51262. COS. 1 hit.
    PS50853. FN3. 1 hit.
    PS50119. ZF_BBOX. 2 hits.
    PS00518. ZF_RING_1. 1 hit.
    PS50089. ZF_RING_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4).
      Strain: C57BL/6J.
      Tissue: Cerebellum, Diencephalon, Head and Hippocampus.
    2. "Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
      Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H.
      DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Brain.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
      Strain: C57BL/6.
      Tissue: Brain.
    4. Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 317-679 (ISOFORM 5).
    5. "TRIM9 is specifically expressed in the embryonic and adult nervous system."
      Berti C., Messali S., Ballabio A., Reymond A., Meroni G.
      Mech. Dev. 113:159-162(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    6. "TRIM9, a novel brain-specific E3 ubiquitin ligase, is repressed in the brain of Parkinson's disease and dementia with Lewy bodies."
      Tanji K., Kamitani T., Mori F., Kakita A., Takahashi H., Wakabayashi K.
      Neurobiol. Dis. 38:210-218(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiTRIM9_MOUSE
    AccessioniPrimary (citable) accession number: Q8C7M3
    Secondary accession number(s): Q6ZQE5
    , Q80WT6, Q8C7Z4, Q8CC32, Q8CEG2, Q99PQ3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 4, 2003
    Last sequence update: August 4, 2003
    Last modified: October 1, 2014
    This is version 118 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3