SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8C7M3

- TRIM9_MOUSE

UniProt

Q8C7M3 - TRIM9_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

E3 ubiquitin-protein ligase TRIM9

Gene
Trim9, Kiaa0282
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

E3 ubiquitin-protein ligase which ubiquitinates itself in cooperation with an E2 enzyme UBE2D2/UBC4 and serves as a targeting signal for proteasomal degradation. May play a role in regulation of neuronal functions. May act as a regulator of synaptic vesicle exocytosis by controlling the availability of SNAP25 for the SNARE complex formation By similarity.

Pathwayi

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri10 – 5041RING-typeAdd
BLAST
Zinc fingeri163 – 21250B box-type 1Add
BLAST
Zinc fingeri224 – 26643B box-type 2Add
BLAST

GO - Molecular functioni

  1. ligase activity Source: UniProtKB-KW
  2. ubiquitin-protein transferase activity Source: UniProtKB
  3. zinc ion binding Source: InterPro

GO - Biological processi

  1. proteasome-mediated ubiquitin-dependent protein catabolic process Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Ubl conjugation pathway

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_199115. Antigen processing: Ubiquitination & Proteasome degradation.
UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
E3 ubiquitin-protein ligase TRIM9 (EC:6.3.2.-)
Alternative name(s):
Tripartite motif-containing protein 9
Gene namesi
Name:Trim9
Synonyms:Kiaa0282
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 12

Organism-specific databases

MGIiMGI:2137354. Trim9.

Subcellular locationi

Cytoplasm. Cell projectiondendrite. Cytoplasmic vesiclesecretory vesiclesynaptic vesicle By similarity. Cell junctionsynapse By similarity. Cytoplasmcytoskeleton By similarity
Note: Enriched at synaptic terminals where it exists in a soluble form and a synaptic vesicle-associated form. Associated with the cytoskeleton By similarity. Found in proximal dendrites of pyramidal neurons in the cerebral cortex and hippocampus, and Purkinje cells in the cerebellum.1 Publication

GO - Cellular componenti

  1. cell junction Source: UniProtKB-KW
  2. cytoplasm Source: UniProtKB
  3. cytoskeleton Source: UniProtKB-SubCell
  4. dendrite Source: UniProtKB
  5. synaptic vesicle Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 817817E3 ubiquitin-protein ligase TRIM9PRO_0000056209Add
BLAST

Post-translational modificationi

Auto-ubiquitinated By similarity.

Keywords - PTMi

Ubl conjugation

Proteomic databases

MaxQBiQ8C7M3.
PaxDbiQ8C7M3.
PRIDEiQ8C7M3.

PTM databases

PhosphoSiteiQ8C7M3.

Expressioni

Tissue specificityi

Brain. Expression is higher in the cerebral cortex and hippocampus (at protein level). Its expression is mainly confined to the central nervous system. The developing neocortex, the dorsal thalamus, the midbrain, the basal area of the hindbrain and spinal cord show high level of expression during embryogenesis. In adult brain, it is detected in the Purkinje cells of the cerebellum, in the hippocampus, and in the cortex.2 Publications

Developmental stagei

First seen at E9.5. From E9.5 to E11.5, it remains uniformly present in the ventral part of the entire neuroepithelium and in the dorsal root ganglia. A more restricted central nervous system (CNS) expression is observed at E13.5 and E15.5 when it is present in specific regions of the forebrain, midbrain, hindbrain and spinal cord.1 Publication

Gene expression databases

ArrayExpressiQ8C7M3.
BgeeiQ8C7M3.
CleanExiMM_TRIM9.
GenevestigatoriQ8C7M3.

Interactioni

Subunit structurei

Interacts with SNAP25 By similarity.

Protein-protein interaction databases

BioGridi220445. 1 interaction.
IntActiQ8C7M3. 1 interaction.
MINTiMINT-4138599.

Structurei

3D structure databases

ProteinModelPortaliQ8C7M3.
SMRiQ8C7M3. Positions 3-39, 163-266, 319-377, 436-537.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini374 – 43259COSAdd
BLAST
Domaini440 – 53596Fibronectin type-IIIAdd
BLAST
Domaini613 – 794182B30.2/SPRYAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili273 – 34068 Reviewed predictionAdd
BLAST

Domaini

The coiled coil domain mediates the interaction with the N-terminal t-SNARE domain of SNAP25 By similarity.

Sequence similaritiesi

Belongs to the TRIM/RBCC family.
Contains 1 B30.2/SPRY domain.
Contains 1 COS domain.

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri10 – 5041RING-typeAdd
BLAST
Zinc fingeri163 – 21250B box-type 1Add
BLAST
Zinc fingeri224 – 26643B box-type 2Add
BLAST

Keywords - Domaini

Coiled coil, Repeat, Zinc-finger

Phylogenomic databases

eggNOGiNOG260378.
GeneTreeiENSGT00740000114914.
HOVERGENiHBG062305.
InParanoidiQ8C7M3.
KOiK10649.
PhylomeDBiQ8C7M3.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
3.30.40.10. 2 hits.
4.10.45.10. 1 hit.
InterProiIPR001870. B30.2/SPRY.
IPR003649. Bbox_C.
IPR008985. ConA-like_lec_gl_sf.
IPR017903. COS_domain.
IPR003961. Fibronectin_type3.
IPR013783. Ig-like_fold.
IPR003877. SPRY_rcpt.
IPR000315. Znf_B-box.
IPR018957. Znf_C3HC4_RING-type.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view]
PfamiPF00041. fn3. 1 hit.
PF00622. SPRY. 1 hit.
PF00643. zf-B_box. 1 hit.
PF00097. zf-C3HC4. 1 hit.
[Graphical view]
SMARTiSM00502. BBC. 1 hit.
SM00336. BBOX. 2 hits.
SM00060. FN3. 1 hit.
SM00184. RING. 1 hit.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 1 hit.
SSF49899. SSF49899. 1 hit.
PROSITEiPS50188. B302_SPRY. 1 hit.
PS51262. COS. 1 hit.
PS50853. FN3. 1 hit.
PS50119. ZF_BBOX. 2 hits.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8C7M3-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MEEMEEELKC PVCGSFYREP IILPCSHNLC QACARNILVQ TPESESPQSR    50
RASGSGVSDY DYLDLDKMSL YSEADSGYGS YGGFASAPTT PCQKSPNGVR 100
VFPPAMPPPP THLSPALAPV PRNSCITCPQ CHRSLILDDR GLRGFPKNRV 150
LEGVIDRYQQ SKAAALKCQL CEKAPKEATV MCEQCDVFYC DPCRLRCHPP 200
RGPLAKHRLV PPAQGRVSRR LSPRKVSTCT DHELENHSMY CVQCKMPVCY 250
QCLEEGKHSS HEVKALGAMW KLHKSQLSQA LNGLSDRAKE AKEFLVQLRT 300
MVQQIQENSV EFEACLVAQC DALIDALNRR KAQLLARVNK EHEHKLKVVR 350
DQISHCTVKL RQTTGLMEYC LEVIKENDPS GFLQISDALI RRVHLTEDQW 400
GKGTLTPRMT TDFDLSLDNS PLLQSIHQLD FVQVKASSPV PATPILQLEE 450
CCTHNNSATL SWKQPPLSTV AADGYILELD DGSGGQFREV YVGKETMCTV 500
DGLHFNSTYN ARVKAFNKTG VSPYSKTLVL QTSEAAGAHE TKPMKDTDSE 550
EQTLPFPVPS ERLPLRRMSP FSSTLNLQPS FPGRSYFDFR SSPHQLSLHS 600
SLQSLNAPGC NFETQSASYS QLVDIKKLLA VAWFAFDPGS AHSDIIFSND 650
NLTVTCSSYD DRVVLGKTGF SKGVHYWELT IDRYDNHPDP AFGVARIDVM 700
KDMMLGKDDK AWAMYVDNNR SWFMHNNSHT NRTEGGITKG ATIGVLLDLN 750
RKTLTFFVNN EQQGPIAFEN VEGLFFPAVS LNRNVQVSLW APGLRACSGC 800
YFKVCPGAVK SPQAPAP 817

Note: May be due to an intron retention.

Length:817
Mass (Da):90,870
Last modified:August 4, 2003 - v2
Checksum:iF23A355F6FF5762D
GO
Isoform 2 (identifier: Q8C7M3-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     535-535: Missing.
     714-732: MYVDNNRSWFMHNNSHTNR → I

Note: May be due to a competing acceptor splice site and to an exon skipping.

Show »
Length:798
Mass (Da):88,507
Checksum:iF078FC75904D43DC
GO
Isoform 3 (identifier: Q8C7M3-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     535-608: Missing.
     714-732: MYVDNNRSWFMHNNSHTNR → I
     788-817: SLWAPGLRACSGCYFKVCPGAVKSPQAPAP → TLHTGLPVPDFYSSRASIA

Note: May be due to a competing donnor splice site and ?.

Show »
Length:714
Mass (Da):79,311
Checksum:i5395B4EDC3465ADD
GO
Isoform 4 (identifier: Q8C7M3-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     546-565: DTDSEEQTLPFPVPSERLPL → GMCGWRQSILRLLGIVLLVD
     566-817: Missing.

Note: May be due to an intron retention.

Show »
Length:565
Mass (Da):62,861
Checksum:i0F105433DEBFC20A
GO
Isoform 5 (identifier: Q8C7M3-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     535-630: Missing.

Note: May be due to exon skipping.

Show »
Length:721
Mass (Da):80,236
Checksum:i291E76ECE8DAAA5E
GO
Isoform 6 (identifier: Q8C7M3-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     535-536: AA → GR
     537-817: Missing.

Note: May be due to an exon inclusion.

Show »
Length:536
Mass (Da):59,727
Checksum:i32EBC120E3D71B91
GO

Sequence cautioni

The sequence BAC97919.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei535 – 63096Missing in isoform 5. VSP_007932Add
BLAST
Alternative sequencei535 – 60874Missing in isoform 3. VSP_007931Add
BLAST
Alternative sequencei535 – 5362AA → GR in isoform 6. VSP_007933
Alternative sequencei535 – 5351Missing in isoform 2. VSP_007930
Alternative sequencei537 – 817281Missing in isoform 6. VSP_007934Add
BLAST
Alternative sequencei546 – 56520DTDSE…ERLPL → GMCGWRQSILRLLGIVLLVD in isoform 4. VSP_007937Add
BLAST
Alternative sequencei566 – 817252Missing in isoform 4. VSP_007938Add
BLAST
Alternative sequencei714 – 73219MYVDN…SHTNR → I in isoform 2 and isoform 3. VSP_007935Add
BLAST
Alternative sequencei788 – 81730SLWAP…QAPAP → TLHTGLPVPDFYSSRASIA in isoform 3. VSP_007936Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti27 – 271H → D in BAC28552. 1 Publication
Sequence conflicti251 – 2511Q → H in BAC33982. 1 Publication
Sequence conflicti254 – 2541E → Q in BAC33982. 1 Publication
Sequence conflicti319 – 3191Q → R in AAG53493. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK049907 mRNA. Translation: BAC33982.1.
AK034029 mRNA. Translation: BAC28552.1.
AK028280 mRNA. Translation: BAC25854.1.
AK048875 mRNA. Translation: BAC33479.1.
AK129109 mRNA. Translation: BAC97919.1. Different initiation.
BC052034 mRNA. Translation: AAH52034.1.
AF220039 mRNA. Translation: AAG53493.1.
CCDSiCCDS49077.1. [Q8C7M3-3]
RefSeqiNP_001103672.1. NM_001110202.1. [Q8C7M3-3]
NP_001103673.1. NM_001110203.1.
NP_001273315.1. NM_001286386.1. [Q8C7M3-6]
NP_001273316.1. NM_001286387.1.
NP_001273317.1. NM_001286388.1.
NP_444397.2. NM_053167.3.
XP_006516471.1. XM_006516408.1. [Q8C7M3-4]
UniGeneiMm.184012.

Genome annotation databases

EnsembliENSMUST00000110520; ENSMUSP00000106149; ENSMUSG00000021071. [Q8C7M3-3]
GeneIDi94090.
KEGGimmu:94090.
UCSCiuc007ntp.3. mouse. [Q8C7M3-1]
uc007nts.2. mouse. [Q8C7M3-2]
uc011ynj.2. mouse. [Q8C7M3-3]
uc011ynl.1. mouse. [Q8C7M3-6]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK049907 mRNA. Translation: BAC33982.1 .
AK034029 mRNA. Translation: BAC28552.1 .
AK028280 mRNA. Translation: BAC25854.1 .
AK048875 mRNA. Translation: BAC33479.1 .
AK129109 mRNA. Translation: BAC97919.1 . Different initiation.
BC052034 mRNA. Translation: AAH52034.1 .
AF220039 mRNA. Translation: AAG53493.1 .
CCDSi CCDS49077.1. [Q8C7M3-3 ]
RefSeqi NP_001103672.1. NM_001110202.1. [Q8C7M3-3 ]
NP_001103673.1. NM_001110203.1.
NP_001273315.1. NM_001286386.1. [Q8C7M3-6 ]
NP_001273316.1. NM_001286387.1.
NP_001273317.1. NM_001286388.1.
NP_444397.2. NM_053167.3.
XP_006516471.1. XM_006516408.1. [Q8C7M3-4 ]
UniGenei Mm.184012.

3D structure databases

ProteinModelPortali Q8C7M3.
SMRi Q8C7M3. Positions 3-39, 163-266, 319-377, 436-537.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 220445. 1 interaction.
IntActi Q8C7M3. 1 interaction.
MINTi MINT-4138599.

PTM databases

PhosphoSitei Q8C7M3.

Proteomic databases

MaxQBi Q8C7M3.
PaxDbi Q8C7M3.
PRIDEi Q8C7M3.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000110520 ; ENSMUSP00000106149 ; ENSMUSG00000021071 . [Q8C7M3-3 ]
GeneIDi 94090.
KEGGi mmu:94090.
UCSCi uc007ntp.3. mouse. [Q8C7M3-1 ]
uc007nts.2. mouse. [Q8C7M3-2 ]
uc011ynj.2. mouse. [Q8C7M3-3 ]
uc011ynl.1. mouse. [Q8C7M3-6 ]

Organism-specific databases

CTDi 114088.
MGIi MGI:2137354. Trim9.
Rougei Search...

Phylogenomic databases

eggNOGi NOG260378.
GeneTreei ENSGT00740000114914.
HOVERGENi HBG062305.
InParanoidi Q8C7M3.
KOi K10649.
PhylomeDBi Q8C7M3.

Enzyme and pathway databases

UniPathwayi UPA00143 .
Reactomei REACT_199115. Antigen processing: Ubiquitination & Proteasome degradation.

Miscellaneous databases

ChiTaRSi TRIM9. mouse.
NextBioi 352073.
PROi Q8C7M3.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q8C7M3.
Bgeei Q8C7M3.
CleanExi MM_TRIM9.
Genevestigatori Q8C7M3.

Family and domain databases

Gene3Di 2.60.40.10. 1 hit.
3.30.40.10. 2 hits.
4.10.45.10. 1 hit.
InterProi IPR001870. B30.2/SPRY.
IPR003649. Bbox_C.
IPR008985. ConA-like_lec_gl_sf.
IPR017903. COS_domain.
IPR003961. Fibronectin_type3.
IPR013783. Ig-like_fold.
IPR003877. SPRY_rcpt.
IPR000315. Znf_B-box.
IPR018957. Znf_C3HC4_RING-type.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view ]
Pfami PF00041. fn3. 1 hit.
PF00622. SPRY. 1 hit.
PF00643. zf-B_box. 1 hit.
PF00097. zf-C3HC4. 1 hit.
[Graphical view ]
SMARTi SM00502. BBC. 1 hit.
SM00336. BBOX. 2 hits.
SM00060. FN3. 1 hit.
SM00184. RING. 1 hit.
[Graphical view ]
SUPFAMi SSF49265. SSF49265. 1 hit.
SSF49899. SSF49899. 1 hit.
PROSITEi PS50188. B302_SPRY. 1 hit.
PS51262. COS. 1 hit.
PS50853. FN3. 1 hit.
PS50119. ZF_BBOX. 2 hits.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4).
    Strain: C57BL/6J.
    Tissue: Cerebellum, Diencephalon, Head and Hippocampus.
  2. "Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H.
    DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Brain.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
    Strain: C57BL/6.
    Tissue: Brain.
  4. Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 317-679 (ISOFORM 5).
  5. "TRIM9 is specifically expressed in the embryonic and adult nervous system."
    Berti C., Messali S., Ballabio A., Reymond A., Meroni G.
    Mech. Dev. 113:159-162(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
  6. "TRIM9, a novel brain-specific E3 ubiquitin ligase, is repressed in the brain of Parkinson's disease and dementia with Lewy bodies."
    Tanji K., Kamitani T., Mori F., Kakita A., Takahashi H., Wakabayashi K.
    Neurobiol. Dis. 38:210-218(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiTRIM9_MOUSE
AccessioniPrimary (citable) accession number: Q8C7M3
Secondary accession number(s): Q6ZQE5
, Q80WT6, Q8C7Z4, Q8CC32, Q8CEG2, Q99PQ3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 4, 2003
Last sequence update: August 4, 2003
Last modified: September 3, 2014
This is version 117 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi