Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8C7M3 (TRIM9_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 116. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
E3 ubiquitin-protein ligase TRIM9

EC=6.3.2.-
Alternative name(s):
Tripartite motif-containing protein 9
Gene names
Name:Trim9
Synonyms:Kiaa0282
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length817 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

E3 ubiquitin-protein ligase which ubiquitinates itself in cooperation with an E2 enzyme UBE2D2/UBC4 and serves as a targeting signal for proteasomal degradation. May play a role in regulation of neuronal functions. May act as a regulator of synaptic vesicle exocytosis by controlling the availability of SNAP25 for the SNARE complex formation By similarity.

Pathway

Protein modification; protein ubiquitination.

Subunit structure

Interacts with SNAP25 By similarity.

Subcellular location

Cytoplasm. Cell projectiondendrite. Cytoplasmic vesiclesecretory vesiclesynaptic vesicle By similarity. Cell junctionsynapse By similarity. Cytoplasmcytoskeleton By similarity. Note: Enriched at synaptic terminals where it exists in a soluble form and a synaptic vesicle-associated form. Associated with the cytoskeleton By similarity. Found in proximal dendrites of pyramidal neurons in the cerebral cortex and hippocampus, and Purkinje cells in the cerebellum. Ref.6

Tissue specificity

Brain. Expression is higher in the cerebral cortex and hippocampus (at protein level). Its expression is mainly confined to the central nervous system. The developing neocortex, the dorsal thalamus, the midbrain, the basal area of the hindbrain and spinal cord show high level of expression during embryogenesis. In adult brain, it is detected in the Purkinje cells of the cerebellum, in the hippocampus, and in the cortex. Ref.5 Ref.6

Developmental stage

First seen at E9.5. From E9.5 to E11.5, it remains uniformly present in the ventral part of the entire neuroepithelium and in the dorsal root ganglia. A more restricted central nervous system (CNS) expression is observed at E13.5 and E15.5 when it is present in specific regions of the forebrain, midbrain, hindbrain and spinal cord. Ref.5

Domain

The coiled coil domain mediates the interaction with the N-terminal t-SNARE domain of SNAP25 By similarity.

Post-translational modification

Auto-ubiquitinated By similarity.

Sequence similarities

Belongs to the TRIM/RBCC family.

Contains 2 B box-type zinc fingers.

Contains 1 B30.2/SPRY domain.

Contains 1 COS domain.

Contains 1 fibronectin type-III domain.

Contains 1 RING-type zinc finger.

Sequence caution

The sequence BAC97919.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 6 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8C7M3-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: May be due to an intron retention.
Isoform 2 (identifier: Q8C7M3-2)

The sequence of this isoform differs from the canonical sequence as follows:
     535-535: Missing.
     714-732: MYVDNNRSWFMHNNSHTNR → I
Note: May be due to a competing acceptor splice site and to an exon skipping.
Isoform 3 (identifier: Q8C7M3-3)

The sequence of this isoform differs from the canonical sequence as follows:
     535-608: Missing.
     714-732: MYVDNNRSWFMHNNSHTNR → I
     788-817: SLWAPGLRACSGCYFKVCPGAVKSPQAPAP → TLHTGLPVPDFYSSRASIA
Note: May be due to a competing donnor splice site and ?.
Isoform 4 (identifier: Q8C7M3-4)

The sequence of this isoform differs from the canonical sequence as follows:
     546-565: DTDSEEQTLPFPVPSERLPL → GMCGWRQSILRLLGIVLLVD
     566-817: Missing.
Note: May be due to an intron retention.
Isoform 5 (identifier: Q8C7M3-5)

The sequence of this isoform differs from the canonical sequence as follows:
     535-630: Missing.
Note: May be due to exon skipping.
Isoform 6 (identifier: Q8C7M3-6)

The sequence of this isoform differs from the canonical sequence as follows:
     535-536: AA → GR
     537-817: Missing.
Note: May be due to an exon inclusion.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 817817E3 ubiquitin-protein ligase TRIM9
PRO_0000056209

Regions

Domain374 – 43259COS
Domain440 – 53596Fibronectin type-III
Domain613 – 794182B30.2/SPRY
Zinc finger10 – 5041RING-type
Zinc finger163 – 21250B box-type 1
Zinc finger224 – 26643B box-type 2
Coiled coil273 – 34068 Potential

Natural variations

Alternative sequence535 – 63096Missing in isoform 5.
VSP_007932
Alternative sequence535 – 60874Missing in isoform 3.
VSP_007931
Alternative sequence535 – 5362AA → GR in isoform 6.
VSP_007933
Alternative sequence5351Missing in isoform 2.
VSP_007930
Alternative sequence537 – 817281Missing in isoform 6.
VSP_007934
Alternative sequence546 – 56520DTDSE…ERLPL → GMCGWRQSILRLLGIVLLVD in isoform 4.
VSP_007937
Alternative sequence566 – 817252Missing in isoform 4.
VSP_007938
Alternative sequence714 – 73219MYVDN…SHTNR → I in isoform 2 and isoform 3.
VSP_007935
Alternative sequence788 – 81730SLWAP…QAPAP → TLHTGLPVPDFYSSRASIA in isoform 3.
VSP_007936

Experimental info

Sequence conflict271H → D in BAC28552. Ref.1
Sequence conflict2511Q → H in BAC33982. Ref.1
Sequence conflict2541E → Q in BAC33982. Ref.1
Sequence conflict3191Q → R in AAG53493. Ref.4

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified August 4, 2003. Version 2.
Checksum: F23A355F6FF5762D

FASTA81790,870
        10         20         30         40         50         60 
MEEMEEELKC PVCGSFYREP IILPCSHNLC QACARNILVQ TPESESPQSR RASGSGVSDY 

        70         80         90        100        110        120 
DYLDLDKMSL YSEADSGYGS YGGFASAPTT PCQKSPNGVR VFPPAMPPPP THLSPALAPV 

       130        140        150        160        170        180 
PRNSCITCPQ CHRSLILDDR GLRGFPKNRV LEGVIDRYQQ SKAAALKCQL CEKAPKEATV 

       190        200        210        220        230        240 
MCEQCDVFYC DPCRLRCHPP RGPLAKHRLV PPAQGRVSRR LSPRKVSTCT DHELENHSMY 

       250        260        270        280        290        300 
CVQCKMPVCY QCLEEGKHSS HEVKALGAMW KLHKSQLSQA LNGLSDRAKE AKEFLVQLRT 

       310        320        330        340        350        360 
MVQQIQENSV EFEACLVAQC DALIDALNRR KAQLLARVNK EHEHKLKVVR DQISHCTVKL 

       370        380        390        400        410        420 
RQTTGLMEYC LEVIKENDPS GFLQISDALI RRVHLTEDQW GKGTLTPRMT TDFDLSLDNS 

       430        440        450        460        470        480 
PLLQSIHQLD FVQVKASSPV PATPILQLEE CCTHNNSATL SWKQPPLSTV AADGYILELD 

       490        500        510        520        530        540 
DGSGGQFREV YVGKETMCTV DGLHFNSTYN ARVKAFNKTG VSPYSKTLVL QTSEAAGAHE 

       550        560        570        580        590        600 
TKPMKDTDSE EQTLPFPVPS ERLPLRRMSP FSSTLNLQPS FPGRSYFDFR SSPHQLSLHS 

       610        620        630        640        650        660 
SLQSLNAPGC NFETQSASYS QLVDIKKLLA VAWFAFDPGS AHSDIIFSND NLTVTCSSYD 

       670        680        690        700        710        720 
DRVVLGKTGF SKGVHYWELT IDRYDNHPDP AFGVARIDVM KDMMLGKDDK AWAMYVDNNR 

       730        740        750        760        770        780 
SWFMHNNSHT NRTEGGITKG ATIGVLLDLN RKTLTFFVNN EQQGPIAFEN VEGLFFPAVS 

       790        800        810 
LNRNVQVSLW APGLRACSGC YFKVCPGAVK SPQAPAP 

« Hide

Isoform 2 [UniParc].

Checksum: F078FC75904D43DC
Show »

FASTA79888,507
Isoform 3 [UniParc].

Checksum: 5395B4EDC3465ADD
Show »

FASTA71479,311
Isoform 4 [UniParc].

Checksum: 0F105433DEBFC20A
Show »

FASTA56562,861
Isoform 5 [UniParc].

Checksum: 291E76ECE8DAAA5E
Show »

FASTA72180,236
Isoform 6 [UniParc].

Checksum: 32EBC120E3D71B91
Show »

FASTA53659,727

References

« Hide 'large scale' references
[1]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4).
Strain: C57BL/6J.
Tissue: Cerebellum, Diencephalon, Head and Hippocampus.
[2]"Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H.
DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Brain.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
Strain: C57BL/6.
Tissue: Brain.
[4]"The tripartite motif family identifies cell compartments."
Reymond A., Meroni G., Fantozzi A., Merla G., Cairo S., Luzi L., Riganelli D., Zanaria E., Messali S., Cainarca S., Guffanti A., Minucci S., Pelicci P.G., Ballabio A.
EMBO J. 20:2140-2151(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 317-679 (ISOFORM 5).
[5]"TRIM9 is specifically expressed in the embryonic and adult nervous system."
Berti C., Messali S., Ballabio A., Reymond A., Meroni G.
Mech. Dev. 113:159-162(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
[6]"TRIM9, a novel brain-specific E3 ubiquitin ligase, is repressed in the brain of Parkinson's disease and dementia with Lewy bodies."
Tanji K., Kamitani T., Mori F., Kakita A., Takahashi H., Wakabayashi K.
Neurobiol. Dis. 38:210-218(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK049907 mRNA. Translation: BAC33982.1.
AK034029 mRNA. Translation: BAC28552.1.
AK028280 mRNA. Translation: BAC25854.1.
AK048875 mRNA. Translation: BAC33479.1.
AK129109 mRNA. Translation: BAC97919.1. Different initiation.
BC052034 mRNA. Translation: AAH52034.1.
AF220039 mRNA. Translation: AAG53493.1.
CCDSCCDS49077.1. [Q8C7M3-3]
RefSeqNP_001103672.1. NM_001110202.1. [Q8C7M3-3]
NP_001103673.1. NM_001110203.1.
NP_001273315.1. NM_001286386.1. [Q8C7M3-6]
NP_001273316.1. NM_001286387.1.
NP_001273317.1. NM_001286388.1.
NP_444397.2. NM_053167.3.
XP_006516471.1. XM_006516408.1. [Q8C7M3-4]
UniGeneMm.184012.

3D structure databases

ProteinModelPortalQ8C7M3.
SMRQ8C7M3. Positions 3-39, 163-266, 319-377, 436-537.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid220445. 1 interaction.
IntActQ8C7M3. 1 interaction.
MINTMINT-4138599.

PTM databases

PhosphoSiteQ8C7M3.

Proteomic databases

MaxQBQ8C7M3.
PaxDbQ8C7M3.
PRIDEQ8C7M3.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000110520; ENSMUSP00000106149; ENSMUSG00000021071. [Q8C7M3-3]
GeneID94090.
KEGGmmu:94090.
UCSCuc007ntp.3. mouse. [Q8C7M3-1]
uc007nts.2. mouse. [Q8C7M3-2]
uc011ynj.2. mouse. [Q8C7M3-3]
uc011ynl.1. mouse. [Q8C7M3-6]

Organism-specific databases

CTD114088.
MGIMGI:2137354. Trim9.
RougeSearch...

Phylogenomic databases

eggNOGNOG260378.
GeneTreeENSGT00740000114914.
HOVERGENHBG062305.
InParanoidQ8C7M3.
KOK10649.
PhylomeDBQ8C7M3.

Enzyme and pathway databases

UniPathwayUPA00143.

Gene expression databases

ArrayExpressQ8C7M3.
BgeeQ8C7M3.
CleanExMM_TRIM9.
GenevestigatorQ8C7M3.

Family and domain databases

Gene3D2.60.40.10. 1 hit.
3.30.40.10. 2 hits.
4.10.45.10. 1 hit.
InterProIPR001870. B30.2/SPRY.
IPR003649. Bbox_C.
IPR008985. ConA-like_lec_gl_sf.
IPR017903. COS_domain.
IPR003961. Fibronectin_type3.
IPR013783. Ig-like_fold.
IPR003877. SPRY_rcpt.
IPR000315. Znf_B-box.
IPR018957. Znf_C3HC4_RING-type.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view]
PfamPF00041. fn3. 1 hit.
PF00622. SPRY. 1 hit.
PF00643. zf-B_box. 1 hit.
PF00097. zf-C3HC4. 1 hit.
[Graphical view]
SMARTSM00502. BBC. 1 hit.
SM00336. BBOX. 2 hits.
SM00060. FN3. 1 hit.
SM00184. RING. 1 hit.
[Graphical view]
SUPFAMSSF49265. SSF49265. 1 hit.
SSF49899. SSF49899. 1 hit.
PROSITEPS50188. B302_SPRY. 1 hit.
PS51262. COS. 1 hit.
PS50853. FN3. 1 hit.
PS50119. ZF_BBOX. 2 hits.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSTRIM9. mouse.
NextBio352073.
PROQ8C7M3.
SOURCESearch...

Entry information

Entry nameTRIM9_MOUSE
AccessionPrimary (citable) accession number: Q8C7M3
Secondary accession number(s): Q6ZQE5 expand/collapse secondary AC list , Q80WT6, Q8C7Z4, Q8CC32, Q8CEG2, Q99PQ3
Entry history
Integrated into UniProtKB/Swiss-Prot: August 4, 2003
Last sequence update: August 4, 2003
Last modified: July 9, 2014
This is version 116 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

PATHWAY comments

Index of metabolic and biosynthesis pathways

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot