Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8C735

- LIN9_MOUSE

UniProt

Q8C735 - LIN9_MOUSE

Protein

Protein lin-9 homolog

Gene

Lin9

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 93 (01 Oct 2014)
      Sequence version 2 (19 Sep 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Acts as a tumor suppressor. Inhibits DNA synthesis. Its ability to inhibit oncogenic transformation is mediated through its association with RB1. Plays a role in the expression of genes required for the G1/S transition By similarity.By similarity

    GO - Biological processi

    1. cell cycle Source: UniProtKB-KW
    2. DNA replication Source: UniProtKB-KW
    3. transcription, DNA-templated Source: InterPro

    Keywords - Biological processi

    Cell cycle, DNA synthesis

    Enzyme and pathway databases

    ReactomeiREACT_199110. G0 and Early G1.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein lin-9 homolog
    Short name:
    mLin-9
    Alternative name(s):
    TUDOR gene similar 1 protein
    Type I interferon receptor beta chain-associated protein
    Gene namesi
    Name:Lin9
    Synonyms:Bara, Tgs1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 1

    Organism-specific databases

    MGIiMGI:1919818. Lin9.

    Subcellular locationi

    Nucleusnucleoplasm By similarity
    Note: Found in perinucleolar structures. Associated with chromatin.By similarity

    GO - Cellular componenti

    1. nucleoplasm Source: UniProtKB-SubCell
    2. transcriptional repressor complex Source: InterPro

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Keywords - Diseasei

    Tumor suppressor

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11RemovedBy similarity
    Chaini2 – 542541Protein lin-9 homologPRO_0000249548Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanineBy similarity
    Modified residuei65 – 651PhosphoserineBy similarity
    Modified residuei304 – 3041PhosphothreonineBy similarity
    Modified residuei309 – 3091PhosphoserineBy similarity
    Modified residuei321 – 3211PhosphoserineBy similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    PaxDbiQ8C735.
    PRIDEiQ8C735.

    PTM databases

    PhosphoSiteiQ8C735.

    Expressioni

    Gene expression databases

    BgeeiQ8C735.
    CleanExiMM_LIN9.
    GenevestigatoriQ8C735.

    Interactioni

    Subunit structurei

    Component of the DREAM complex (also named LINC complex) at least composed of E2F4, E2F5, LIN9, LIN37, LIN52, LIN54, MYBL1, MYBL2, RBL1, RBL2, RBBP4, TFDP1 and TFDP2. The complex exists in quiescent cells where it represses cell cycle-dependent genes. It dissociates in S phase when LIN9, LIN37, LIN52 and LIN54 form a subcomplex that binds to MYBL2. Interacts with RB1 By similarity.By similarity

    Protein-protein interaction databases

    STRINGi10090.ENSMUSP00000082959.

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the lin-9 family.Curated

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG148048.
    GeneTreeiENSGT00390000003188.
    HOGENOMiHOG000007517.
    HOVERGENiHBG057743.
    InParanoidiQ8C735.
    OMAiNEPNETM.
    OrthoDBiEOG71ZP10.
    PhylomeDBiQ8C735.
    TreeFamiTF314315.

    Family and domain databases

    InterProiIPR010561. LIN-9/ALY1.
    [Graphical view]
    PANTHERiPTHR21689. PTHR21689. 1 hit.
    PfamiPF06584. DIRP. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8C735-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAELDQLPDE SSSAKALVSL KEGSLSNTWN EKYSSLQKTP VWKGRNAGPA    50
    VEMPFRNSKR SRLFSDEDDR QINTKSPKRN QRVAMIPQKF TATMSTPDKK 100
    ASQKIGFRLR NLLKLPKAHK WCIYEWFYSN IDKPLFEGDN DFCVCLKESF 150
    PNLKTRKLTR VEWGKIRRLM GKPRRCSSAF FEEERSALKQ KRQKIRLLQQ 200
    RKVADVSQFK DLPDEIPLPL VIGTKVTARL RGIHDGLFTG QIDAVDTLNA 250
    TYRVTFDRTG LGTHTIPDYE VLSNEPHETM PISAFGQKQR PSRFFMTPPR 300
    LHYTPPLQSP ITDGDPLLGQ SPWRSKVSGS DTETLGGFPV EFLIQVTKLS 350
    KILMIKKEHI KKLREMNTEA EKLKSYSMPI GIEFQRRYAT IVLELEQLNK 400
    DLNKVLHKVQ QYCYELAPDQ GLQPADQPTD MRRRCEEEAQ EIVRQANSAS 450
    GQPCVENENL TDLISRLTAI LLQIKCLAEG GDLNSFEFKS LTDSLNDIKN 500
    TIDASNISCF QNNVEIHVAH IQSGLSQMGN LHAFAANNTN RD 542
    Length:542
    Mass (Da):61,759
    Last modified:September 19, 2006 - v2
    Checksum:i9F99F9DB3D2568E4
    GO
    Isoform 2 (identifier: Q8C735-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         416-542: LAPDQGLQPA...AFAANNTNRD → VSGVYCFHWC...NDFTFTFCKL

    Show »
    Length:502
    Mass (Da):57,632
    Checksum:i016036D114A835E5
    GO
    Isoform 3 (identifier: Q8C735-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         176-205: CSSAFFEEERSALKQKRQKIRLLQQRKVAD → EISLKTEAAENQAVTTKESCRCFTVQRSPR
         206-542: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:205
    Mass (Da):23,749
    Checksum:i66167964175000D4
    GO

    Sequence cautioni

    The sequence BAC31235.1 differs from that shown. Reason: Frameshift at position 18.
    The sequence AAQ13712.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti152 – 1521N → K in BAC35065. (PubMed:16141072)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei176 – 20530CSSAF…RKVAD → EISLKTEAAENQAVTTKESC RCFTVQRSPR in isoform 3. 1 PublicationVSP_020511Add
    BLAST
    Alternative sequencei206 – 542337Missing in isoform 3. 1 PublicationVSP_020512Add
    BLAST
    Alternative sequencei416 – 542127LAPDQ…NTNRD → VSGVYCFHWCFVLFCFVILV FFEMGSHSVAMAALETSLAS SSEIRLFLPPSAGIKGVRHH AQPNVCCFPSMFCYLKLNDF TFTFCKL in isoform 2. 1 PublicationVSP_020513Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK042357 mRNA. Translation: BAC31235.1. Frameshift.
    AK052618 mRNA. Translation: BAC35065.1.
    AF190325 mRNA. Translation: AAQ13712.1. Different initiation.
    UniGeneiMm.275044.

    Genome annotation databases

    EnsembliENSMUST00000085803; ENSMUSP00000082959; ENSMUSG00000058729. [Q8C735-1]
    ENSMUST00000085804; ENSMUSP00000082960; ENSMUSG00000058729. [Q8C735-2]
    KEGGimmu:72568.
    UCSCiuc007dwk.2. mouse. [Q8C735-1]
    uc007dwl.2. mouse. [Q8C735-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK042357 mRNA. Translation: BAC31235.1 . Frameshift.
    AK052618 mRNA. Translation: BAC35065.1 .
    AF190325 mRNA. Translation: AAQ13712.1 . Different initiation.
    UniGenei Mm.275044.

    3D structure databases

    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 10090.ENSMUSP00000082959.

    PTM databases

    PhosphoSitei Q8C735.

    Proteomic databases

    PaxDbi Q8C735.
    PRIDEi Q8C735.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000085803 ; ENSMUSP00000082959 ; ENSMUSG00000058729 . [Q8C735-1 ]
    ENSMUST00000085804 ; ENSMUSP00000082960 ; ENSMUSG00000058729 . [Q8C735-2 ]
    KEGGi mmu:72568.
    UCSCi uc007dwk.2. mouse. [Q8C735-1 ]
    uc007dwl.2. mouse. [Q8C735-2 ]

    Organism-specific databases

    CTDi 286826.
    MGIi MGI:1919818. Lin9.

    Phylogenomic databases

    eggNOGi NOG148048.
    GeneTreei ENSGT00390000003188.
    HOGENOMi HOG000007517.
    HOVERGENi HBG057743.
    InParanoidi Q8C735.
    OMAi NEPNETM.
    OrthoDBi EOG71ZP10.
    PhylomeDBi Q8C735.
    TreeFami TF314315.

    Enzyme and pathway databases

    Reactomei REACT_199110. G0 and Early G1.

    Miscellaneous databases

    NextBioi 336515.
    PROi Q8C735.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q8C735.
    CleanExi MM_LIN9.
    Genevestigatori Q8C735.

    Family and domain databases

    InterProi IPR010561. LIN-9/ALY1.
    [Graphical view ]
    PANTHERi PTHR21689. PTHR21689. 1 hit.
    Pfami PF06584. DIRP. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 2-205 (ISOFORM 3).
      Strain: C57BL/6J.
      Tissue: Kidney and Thymus.
    2. "A mutant allele of BARA/LIN-9 rescues the cdk4-/- phenotype by releasing the repression on E2F-regulated genes."
      Sandoval R., Xue J., Tian X., Barrett K., Pilkinton M., Ucker D.S., Raychaudhuri P., Kineman R.D., Luque R.M., Baida G., Zou X., Valli V.E., Cook J.L., Kiyokawa H., Colamonici O.R.
      Exp. Cell Res. 312:2465-2475(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-537 (ISOFORM 1).

    Entry informationi

    Entry nameiLIN9_MOUSE
    AccessioniPrimary (citable) accession number: Q8C735
    Secondary accession number(s): Q5TKA0, Q8C9D8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 19, 2006
    Last sequence update: September 19, 2006
    Last modified: October 1, 2014
    This is version 93 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3