Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8C735

- LIN9_MOUSE

UniProt

Q8C735 - LIN9_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein lin-9 homolog

Gene

Lin9

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Functioni

Acts as a tumor suppressor. Inhibits DNA synthesis. Its ability to inhibit oncogenic transformation is mediated through its association with RB1. Plays a role in the expression of genes required for the G1/S transition (By similarity).By similarity

GO - Biological processi

  1. cell cycle Source: UniProtKB-KW
  2. DNA replication Source: UniProtKB-KW
  3. transcription, DNA-templated Source: InterPro
Complete GO annotation...

Keywords - Biological processi

Cell cycle, DNA synthesis

Enzyme and pathway databases

ReactomeiREACT_199110. G0 and Early G1.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein lin-9 homolog
Short name:
mLin-9
Alternative name(s):
TUDOR gene similar 1 protein
Type I interferon receptor beta chain-associated protein
Gene namesi
Name:Lin9
Synonyms:Bara, Tgs1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 1

Organism-specific databases

MGIiMGI:1919818. Lin9.

Subcellular locationi

Nucleusnucleoplasm By similarity
Note: Found in perinucleolar structures. Associated with chromatin.By similarity

GO - Cellular componenti

  1. nucleus Source: UniProtKB-KW
  2. transcriptional repressor complex Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Keywords - Diseasei

Tumor suppressor

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11RemovedBy similarity
Chaini2 – 542541Protein lin-9 homologPRO_0000249548Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanineBy similarity
Modified residuei65 – 651PhosphoserineBy similarity
Modified residuei304 – 3041PhosphothreonineBy similarity
Modified residuei309 – 3091PhosphoserineBy similarity
Modified residuei321 – 3211PhosphoserineBy similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ8C735.
PaxDbiQ8C735.
PRIDEiQ8C735.

PTM databases

PhosphoSiteiQ8C735.

Expressioni

Gene expression databases

BgeeiQ8C735.
CleanExiMM_LIN9.
GenevestigatoriQ8C735.

Interactioni

Subunit structurei

Component of the DREAM complex (also named LINC complex) at least composed of E2F4, E2F5, LIN9, LIN37, LIN52, LIN54, MYBL1, MYBL2, RBL1, RBL2, RBBP4, TFDP1 and TFDP2. The complex exists in quiescent cells where it represses cell cycle-dependent genes. It dissociates in S phase when LIN9, LIN37, LIN52 and LIN54 form a subcomplex that binds to MYBL2. Interacts with RB1 (By similarity).By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000082959.

Family & Domainsi

Sequence similaritiesi

Belongs to the lin-9 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG148048.
GeneTreeiENSGT00390000003188.
HOGENOMiHOG000007517.
HOVERGENiHBG057743.
InParanoidiQ8C735.
OMAiNEPNETM.
OrthoDBiEOG71ZP10.
PhylomeDBiQ8C735.
TreeFamiTF314315.

Family and domain databases

InterProiIPR010561. LIN-9/ALY1.
[Graphical view]
PANTHERiPTHR21689. PTHR21689. 1 hit.
PfamiPF06584. DIRP. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8C735-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAELDQLPDE SSSAKALVSL KEGSLSNTWN EKYSSLQKTP VWKGRNAGPA
60 70 80 90 100
VEMPFRNSKR SRLFSDEDDR QINTKSPKRN QRVAMIPQKF TATMSTPDKK
110 120 130 140 150
ASQKIGFRLR NLLKLPKAHK WCIYEWFYSN IDKPLFEGDN DFCVCLKESF
160 170 180 190 200
PNLKTRKLTR VEWGKIRRLM GKPRRCSSAF FEEERSALKQ KRQKIRLLQQ
210 220 230 240 250
RKVADVSQFK DLPDEIPLPL VIGTKVTARL RGIHDGLFTG QIDAVDTLNA
260 270 280 290 300
TYRVTFDRTG LGTHTIPDYE VLSNEPHETM PISAFGQKQR PSRFFMTPPR
310 320 330 340 350
LHYTPPLQSP ITDGDPLLGQ SPWRSKVSGS DTETLGGFPV EFLIQVTKLS
360 370 380 390 400
KILMIKKEHI KKLREMNTEA EKLKSYSMPI GIEFQRRYAT IVLELEQLNK
410 420 430 440 450
DLNKVLHKVQ QYCYELAPDQ GLQPADQPTD MRRRCEEEAQ EIVRQANSAS
460 470 480 490 500
GQPCVENENL TDLISRLTAI LLQIKCLAEG GDLNSFEFKS LTDSLNDIKN
510 520 530 540
TIDASNISCF QNNVEIHVAH IQSGLSQMGN LHAFAANNTN RD
Length:542
Mass (Da):61,759
Last modified:September 19, 2006 - v2
Checksum:i9F99F9DB3D2568E4
GO
Isoform 2 (identifier: Q8C735-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     416-542: LAPDQGLQPA...AFAANNTNRD → VSGVYCFHWC...NDFTFTFCKL

Show »
Length:502
Mass (Da):57,632
Checksum:i016036D114A835E5
GO
Isoform 3 (identifier: Q8C735-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     176-205: CSSAFFEEERSALKQKRQKIRLLQQRKVAD → EISLKTEAAENQAVTTKESCRCFTVQRSPR
     206-542: Missing.

Note: No experimental confirmation available.

Show »
Length:205
Mass (Da):23,749
Checksum:i66167964175000D4
GO

Sequence cautioni

The sequence BAC31235.1 differs from that shown. Reason: Frameshift at position 18.
The sequence AAQ13712.1 differs from that shown. Reason: Erroneous initiation.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti152 – 1521N → K in BAC35065. (PubMed:16141072)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei176 – 20530CSSAF…RKVAD → EISLKTEAAENQAVTTKESC RCFTVQRSPR in isoform 3. 1 PublicationVSP_020511Add
BLAST
Alternative sequencei206 – 542337Missing in isoform 3. 1 PublicationVSP_020512Add
BLAST
Alternative sequencei416 – 542127LAPDQ…NTNRD → VSGVYCFHWCFVLFCFVILV FFEMGSHSVAMAALETSLAS SSEIRLFLPPSAGIKGVRHH AQPNVCCFPSMFCYLKLNDF TFTFCKL in isoform 2. 1 PublicationVSP_020513Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK042357 mRNA. Translation: BAC31235.1. Frameshift.
AK052618 mRNA. Translation: BAC35065.1.
AF190325 mRNA. Translation: AAQ13712.1. Different initiation.
UniGeneiMm.275044.

Genome annotation databases

EnsembliENSMUST00000085803; ENSMUSP00000082959; ENSMUSG00000058729. [Q8C735-1]
ENSMUST00000085804; ENSMUSP00000082960; ENSMUSG00000058729. [Q8C735-2]
KEGGimmu:72568.
UCSCiuc007dwk.2. mouse. [Q8C735-1]
uc007dwl.2. mouse. [Q8C735-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK042357 mRNA. Translation: BAC31235.1 . Frameshift.
AK052618 mRNA. Translation: BAC35065.1 .
AF190325 mRNA. Translation: AAQ13712.1 . Different initiation.
UniGenei Mm.275044.

3D structure databases

ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 10090.ENSMUSP00000082959.

PTM databases

PhosphoSitei Q8C735.

Proteomic databases

MaxQBi Q8C735.
PaxDbi Q8C735.
PRIDEi Q8C735.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000085803 ; ENSMUSP00000082959 ; ENSMUSG00000058729 . [Q8C735-1 ]
ENSMUST00000085804 ; ENSMUSP00000082960 ; ENSMUSG00000058729 . [Q8C735-2 ]
KEGGi mmu:72568.
UCSCi uc007dwk.2. mouse. [Q8C735-1 ]
uc007dwl.2. mouse. [Q8C735-2 ]

Organism-specific databases

MGIi MGI:1919818. Lin9.

Phylogenomic databases

eggNOGi NOG148048.
GeneTreei ENSGT00390000003188.
HOGENOMi HOG000007517.
HOVERGENi HBG057743.
InParanoidi Q8C735.
OMAi NEPNETM.
OrthoDBi EOG71ZP10.
PhylomeDBi Q8C735.
TreeFami TF314315.

Enzyme and pathway databases

Reactomei REACT_199110. G0 and Early G1.

Miscellaneous databases

NextBioi 336515.
PROi Q8C735.
SOURCEi Search...

Gene expression databases

Bgeei Q8C735.
CleanExi MM_LIN9.
Genevestigatori Q8C735.

Family and domain databases

InterProi IPR010561. LIN-9/ALY1.
[Graphical view ]
PANTHERi PTHR21689. PTHR21689. 1 hit.
Pfami PF06584. DIRP. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 2-205 (ISOFORM 3).
    Strain: C57BL/6J.
    Tissue: Kidney and Thymus.
  2. "A mutant allele of BARA/LIN-9 rescues the cdk4-/- phenotype by releasing the repression on E2F-regulated genes."
    Sandoval R., Xue J., Tian X., Barrett K., Pilkinton M., Ucker D.S., Raychaudhuri P., Kineman R.D., Luque R.M., Baida G., Zou X., Valli V.E., Cook J.L., Kiyokawa H., Colamonici O.R.
    Exp. Cell Res. 312:2465-2475(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-537 (ISOFORM 1).

Entry informationi

Entry nameiLIN9_MOUSE
AccessioniPrimary (citable) accession number: Q8C735
Secondary accession number(s): Q5TKA0, Q8C9D8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 19, 2006
Last sequence update: September 19, 2006
Last modified: October 29, 2014
This is version 94 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3