Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Succinate dehydrogenase assembly factor 2, mitochondrial

Gene

Sdhaf2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Required for flavinylation (covalent attachment of FAD) of the flavoprotein subunit SDHA of the SDH catalytic dimer.UniRule annotation

GO - Biological processi

  • mitochondrial electron transport, succinate to ubiquinone Source: UniProtKB
  • negative regulation of canonical Wnt signaling pathway Source: MGI
  • negative regulation of epithelial to mesenchymal transition Source: MGI
  • protein dephosphorylation Source: MGI
  • protein-FAD linkage Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Chaperone

Names & Taxonomyi

Protein namesi
Recommended name:
Succinate dehydrogenase assembly factor 2, mitochondrialUniRule annotation
Short name:
SDH assembly factor 2UniRule annotation
Short name:
SDHAF2UniRule annotation
Gene namesi
Name:Sdhaf2UniRule annotation
Synonyms:Pgl2UniRule annotation, Sdh5UniRule annotation
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 19

Organism-specific databases

MGIiMGI:1913322. Sdhaf2.

Subcellular locationi

  • Mitochondrion matrix UniRule annotation

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 27MitochondrionSequence analysisAdd BLAST27
ChainiPRO_000029435828 – 164Succinate dehydrogenase assembly factor 2, mitochondrialAdd BLAST137

Proteomic databases

EPDiQ8C6I2.
PaxDbiQ8C6I2.
PeptideAtlasiQ8C6I2.
PRIDEiQ8C6I2.

PTM databases

iPTMnetiQ8C6I2.
PhosphoSitePlusiQ8C6I2.

Expressioni

Gene expression databases

BgeeiENSMUSG00000024668.
CleanExiMM_0610038F07RIK.
GenevisibleiQ8C6I2. MM.

Interactioni

Subunit structurei

Interacts with SDHA within the SDH catalytic dimer.UniRule annotation

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000025570.

Structurei

3D structure databases

ProteinModelPortaliQ8C6I2.
SMRiQ8C6I2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the SDHAF2 family.UniRule annotation

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiKOG3326. Eukaryota.
COG2938. LUCA.
GeneTreeiENSGT00390000001149.
HOGENOMiHOG000230636.
InParanoidiQ8C6I2.
KOiK18168.
OMAiYLFEKPH.
OrthoDBiEOG091G0VSZ.
PhylomeDBiQ8C6I2.
TreeFamiTF300175.

Family and domain databases

Gene3Di1.10.150.250. 1 hit.
HAMAPiMF_03057. SDHAF2. 1 hit.
InterProiIPR005631. SDH.
IPR028882. SDHAF2.
[Graphical view]
PfamiPF03937. Sdh5. 1 hit.
[Graphical view]
SUPFAMiSSF109910. SSF109910. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8C6I2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAVVTLIPTL ARALSKHSLL SPLPSVTSFR RFYRGDSPTD SQKDMIEIPL
60 70 80 90 100
PPWQERTDES IETKRARLLY ESRKRGMLEN CILLSLFAKE YLHNMTEKQL
110 120 130 140 150
NLYDRLINEP SNDWDIYYWA TEAKPAPEIF ENEVMELLRE FAKNKNKEQR
160
LRAPDLEYLF EKPH
Length:164
Mass (Da):19,431
Last modified:March 1, 2003 - v1
Checksum:iCDC12D451D532BA4
GO
Isoform 2 (identifier: Q8C6I2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     122-164: EAKPAPEIFENEVMELLREFAKNKNKEQRLRAPDLEYLFEKPH → GMPYAELHLGIIR

Note: No experimental confirmation available.
Show »
Length:134
Mass (Da):15,702
Checksum:i47578142A53EB5C0
GO
Isoform 3 (identifier: Q8C6I2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-94: Missing.

Note: No experimental confirmation available.
Show »
Length:70
Mass (Da):8,574
Checksum:i11F13375979B4CD9
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti27T → K in BAB28863 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0266331 – 94Missing in isoform 3. 1 PublicationAdd BLAST94
Alternative sequenceiVSP_026634122 – 164EAKPA…FEKPH → GMPYAELHLGIIR in isoform 2. 1 PublicationAdd BLAST43

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK160175 mRNA. Translation: BAE35674.1.
AK013454 mRNA. Translation: BAB28863.1.
AK075594 mRNA. Translation: BAC35843.1.
AK160957 mRNA. Translation: BAE36113.1.
AK167228 mRNA. Translation: BAE39352.1.
BC029630 mRNA. Translation: AAH29630.1.
BC038924 mRNA. Translation: AAH38924.1.
BC048913 mRNA. Translation: AAH48913.1.
BC060090 mRNA. Translation: AAH60090.1.
BC085277 mRNA. Translation: AAH85277.1.
CCDSiCCDS29578.1. [Q8C6I2-1]
RefSeqiNP_079609.2. NM_025333.4. [Q8C6I2-1]
UniGeneiMm.180063.
Mm.490260.

Genome annotation databases

EnsembliENSMUST00000025570; ENSMUSP00000025570; ENSMUSG00000024668. [Q8C6I2-1]
GeneIDi66072.
KEGGimmu:66072.
UCSCiuc008gpt.2. mouse. [Q8C6I2-1]
uc008gpv.1. mouse. [Q8C6I2-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK160175 mRNA. Translation: BAE35674.1.
AK013454 mRNA. Translation: BAB28863.1.
AK075594 mRNA. Translation: BAC35843.1.
AK160957 mRNA. Translation: BAE36113.1.
AK167228 mRNA. Translation: BAE39352.1.
BC029630 mRNA. Translation: AAH29630.1.
BC038924 mRNA. Translation: AAH38924.1.
BC048913 mRNA. Translation: AAH48913.1.
BC060090 mRNA. Translation: AAH60090.1.
BC085277 mRNA. Translation: AAH85277.1.
CCDSiCCDS29578.1. [Q8C6I2-1]
RefSeqiNP_079609.2. NM_025333.4. [Q8C6I2-1]
UniGeneiMm.180063.
Mm.490260.

3D structure databases

ProteinModelPortaliQ8C6I2.
SMRiQ8C6I2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000025570.

PTM databases

iPTMnetiQ8C6I2.
PhosphoSitePlusiQ8C6I2.

Proteomic databases

EPDiQ8C6I2.
PaxDbiQ8C6I2.
PeptideAtlasiQ8C6I2.
PRIDEiQ8C6I2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000025570; ENSMUSP00000025570; ENSMUSG00000024668. [Q8C6I2-1]
GeneIDi66072.
KEGGimmu:66072.
UCSCiuc008gpt.2. mouse. [Q8C6I2-1]
uc008gpv.1. mouse. [Q8C6I2-2]

Organism-specific databases

CTDi54949.
MGIiMGI:1913322. Sdhaf2.

Phylogenomic databases

eggNOGiKOG3326. Eukaryota.
COG2938. LUCA.
GeneTreeiENSGT00390000001149.
HOGENOMiHOG000230636.
InParanoidiQ8C6I2.
KOiK18168.
OMAiYLFEKPH.
OrthoDBiEOG091G0VSZ.
PhylomeDBiQ8C6I2.
TreeFamiTF300175.

Miscellaneous databases

PROiQ8C6I2.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000024668.
CleanExiMM_0610038F07RIK.
GenevisibleiQ8C6I2. MM.

Family and domain databases

Gene3Di1.10.150.250. 1 hit.
HAMAPiMF_03057. SDHAF2. 1 hit.
InterProiIPR005631. SDH.
IPR028882. SDHAF2.
[Graphical view]
PfamiPF03937. Sdh5. 1 hit.
[Graphical view]
SUPFAMiSSF109910. SSF109910. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiSDHF2_MOUSE
AccessioniPrimary (citable) accession number: Q8C6I2
Secondary accession number(s): Q3TVE5
, Q6PAS5, Q80ZJ9, Q8K2W8, Q9CYQ2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: March 1, 2003
Last modified: November 2, 2016
This is version 98 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.