Reviewed,
UniProtKB/Swiss-Prot Q8C6I2 (SDHF2_MOUSE)
Last modified
November 24, 2009.
Version 49.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Succinate dehydrogenase assembly factor 2, mitochondrial Short name=SDH assembly factor 2 Alternative name(s): Succinate dehydrogenase subunit 5, mitochondrial | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 164 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Required for insertion of FAD cofactor into SDHA, the catalytic subunit of succinate dehydrogenase (SDH). SDH is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). In is unclear whether it participates in the chemistry of FAD attachment (enzymatic function) or acts as a chaperone that maintains SDHA in a conformation that is susceptible to autocatalytic FAD attachment By similarity. |
| Subunit structure | Interacts with SDHA By similarity. |
| Subcellular location | Mitochondrion By similarity. |
| Sequence similarities | Belongs to the SDHAF2 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Mitochondrion |
| Coding sequence diversity | Alternative splicing |
| Domain | Transit peptide |
| Gene Ontology (GO) | |
| Biological process | mitochondrial electron transport, succinate to ubiquinone Inferred from sequence or structural similarity. Source: UniProtKB protein-FAD linkageInferred from sequence or structural similarity. Source: UniProtKB |
| Cellular component | mitochondrion Inferred from sequence or structural similarity. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8C6I2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8C6I2-2) The sequence of this isoform differs from the canonical sequence as follows: 122-164: EAKPAPEIFENEVMELLREFAKNKNKEQRLRAPDLEYLFEKPH → GMPYAELHLGIIR | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q8C6I2-3) The sequence of this isoform differs from the canonical sequence as follows: 1-94: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 27 | 27 | Mitochondrion Potential | ||||||
| Chain | 28 – 164 | 137 | Succinate dehydrogenase assembly factor 2, mitochondrial | PRO_0000294358 | |||||
Natural variations | |||||||||
| Alternative sequence | 1 – 94 | 94 | Missing in isoform 3. | VSP_026633 | |||||
| Alternative sequence | 122 – 164 | 43 | EAKPA…FEKPH → GMPYAELHLGIIR in isoform 2. | VSP_026634 | |||||
Experimental info | |||||||||
| Sequence conflict | 27 | 1 | T → K in BAB28863. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: C57BL/6J. Tissue: Head, Kidney and Stomach. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). Strain: C57BL/6 and FVB/N. Tissue: Brain, Embryo, Eye and Mammary tumor. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AK160175 mRNA. Translation: BAE35674.1. AK013454 mRNA. Translation: BAB28863.1. AK075594 mRNA. Translation: BAC35843.1. AK160957 mRNA. Translation: BAE36113.1. AK167228 mRNA. Translation: BAE39352.1. BC029630 mRNA. Translation: AAH29630.1. BC038924 mRNA. Translation: AAH38924.1. BC048913 mRNA. Translation: AAH48913.1. BC060090 mRNA. Translation: AAH60090.1. BC085277 mRNA. Translation: AAH85277.1. | |
| IPI | IPI00312113. IPI00461231. IPI00853857. |
| RefSeq | NP_079609.2. |
| UniGene | Mm.180063 Mm.293980 |
3D structure databases | |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q8C6I2. |
Proteomic databases | |
| PRIDE | Q8C6I2. |
Genome annotation databases | |
| Ensembl | ENSMUST00000025570; ENSMUSP00000025570; ENSMUSG00000024668; Mus musculus. [Genome view] |
| GeneID | 66072. |
| KEGG | mmu:66072. |
| NMPDR | fig|10090.3.peg.4662. |
| UCSC | uc008gpt.1. mouse. |
Organism-specific databases | |
| CTD | 66072. |
| MGI | MGI:1913322. Sdhaf2. |
Phylogenomic databases | |
| HOGENOM | Q8C6I2. |
| HOVERGEN | Q8C6I2. |
| OMA | IFENEVM |
| OrthoDB | EOG9P5NWK |
Gene expression databases | |
| ArrayExpress | Q8C6I2. |
| Bgee | Q8C6I2. |
| CleanEx | MM_0610038F07RIK. |
| Genevestigator | Q8C6I2. |
Family and domain databases | |
| InterPro | IPR005631. DUF339. [Graphical view] |
| Gene3D | G3DSA:1.10.150.250. DUF339. 1 hit. |
| Pfam | PF03937. DUF339. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 320544. |
| SOURCE | Search... |
Entry information
| Entry name | SDHF2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8C6I2 Secondary accession number(s): Q3TVE5 Q9CYQ2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


