Q8C6B2 (RTKN_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 72.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Rhotekin | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 564 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Mediates Rho signaling to activate NF-kappa-B and may confer increased resistance to apoptosis to cells in gastric tumorigenesis. May play a novel role in the organization of septin structures By similarity. |
| Subunit structure | Interacts via its C-terminal region with the TAX1BP3 PDZ domain. This interaction facilitates Rho-mediated activation of the c-Fos serum response element (SRE). Interacts with SEPT9 By similarity. Specifically binds to GTP-bound RHOA, RHOB and RHOC and inhibits their GTPase activity. Ref.1 UniProtKB Q9BST9 |
| Tissue specificity | Abundantly expressed in brain and kidney. Weakly expressed in lung, testis, skeletal muscle, heart and thymus. Ref.1 |
| Sequence similarities | Contains 1 PH domain. Contains 1 REM (Hr1) repeat. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis |
| Coding sequence diversity | Alternative splicing |
| Ligand | GTP-binding Nucleotide-binding |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | Rho protein signal transduction Inferred from sequence or structural similarity. Source: UniProtKB apoptotic processInferred from electronic annotation. Source: UniProtKB-KW regulation of anti-apoptosisInferred from sequence or structural similarity. Source: UniProtKB |
| Cellular component | intracellular Inferred from electronic annotation. Source: InterPro |
| Molecular function | GTP binding Inferred from electronic annotation. Source: UniProtKB-KW GTP-Rho bindingInferred from direct assay Ref.1. Source: UniProtKB GTPase inhibitor activityInferred from direct assay Ref.1. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 Ref.2 (identifier: Q8C6B2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 2 Ref.1 (identifier: Q8C6B2-2) The sequence of this isoform differs from the canonical sequence as follows: 1-36: MFSRNHRSRITVARGSALEMEFKRGRFRLSFFSESP → MQDRLRILEDLNMLYIRQMALSL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 564 | 564 | Rhotekin | PRO_0000233941 | |||||
Regions | |||||||||
| Repeat | 36 – 99 | 64 | REM | ||||||
| Domain | 309 – 416 | 108 | PH | ||||||
| Compositional bias | 479 – 545 | 67 | Pro-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 106 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 232 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 520 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 544 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 36 | 36 | MFSRN…FSESP → MQDRLRILEDLNMLYIRQMA LSL in isoform 2. Ref.1 | VSP_052006 | |||||
Experimental info | |||||||||
| Sequence conflict | 67 | 1 | Q → L in BAC36222. Ref.2 | ||||||
| Sequence conflict | 365 | 1 | R → G in AAH13820. Ref.4 | ||||||
| Sequence conflict | 444 | 1 | A → V in AAC52605. Ref.1 | ||||||
| Sequence conflict | 444 | 1 | A → V in AAH13820. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Rhotekin, a new putative target for Rho bearing homology to a serine/threonine kinase, PKN, and rhophilin in the rho-binding domain." Reid T., Furuyashiki T., Ishizaki T., Watanabe G., Watanabe N., Fujisawa K., Morii N., Madaule P., Narumiya S. J. Biol. Chem. 271:13556-13560(1996) [PubMed: 8662891] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INTERACTION WITH RHOA; RHOB AND RHOC, TISSUE SPECIFICITY. Tissue: Brain. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: C57BL/6J. Tissue: Head. |
| [3] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed: 19468303] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: FVB/N. Tissue: Mammary gland. |
| [5] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed: 19367708] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-106 AND SER-520, MASS SPECTROMETRY. Tissue: Melanoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U54638 mRNA. Translation: AAC52605.1. AK076155 mRNA. Translation: BAC36222.1. AC104324 Genomic DNA. No translation available. BC013820 mRNA. Translation: AAH13820.1. |
| IPI | IPI00226220. IPI01008657. |
| RefSeq | NP_001129699.1. NM_001136227.1. NP_033132.2. NM_009106.2. NP_598396.2. NM_133641.2. |
| UniGene | Mm.4139. |
3D structure databases | |
| ProteinModelPortal | Q8C6B2. |
| SMR | Q8C6B2. Positions 310-415. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-29983N. |
| IntAct | Q8C6B2. 4 interactions. |
| MINT | MINT-1791510. |
| STRING | Q8C6B2. |
PTM databases | |
| PhosphoSite | Q8C6B2. |
Proteomic databases | |
| PRIDE | Q8C6B2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000065512; ENSMUSP00000065571; ENSMUSG00000034930. ENSMUST00000087938; ENSMUSP00000085249; ENSMUSG00000034930. ENSMUST00000121093; ENSMUSP00000112501; ENSMUSG00000034930. |
| GeneID | 20166. |
| KEGG | mmu:20166. |
| UCSC | uc009cms.2. mouse. uc009cmt.2. mouse. |
Organism-specific databases | |
| CTD | 6242. |
| MGI | MGI:107371. Rtkn. |
Phylogenomic databases | |
| eggNOG | roNOG11996. |
| GeneTree | ENSGT00390000000104. |
| HOGENOM | HBG715547. |
| HOVERGEN | HBG059480. |
| InParanoid | Q8C6B2. |
| OrthoDB | EOG46143R. |
Gene expression databases | |
| ArrayExpress | Q8C6B2. |
| Bgee | Q8C6B2. |
| CleanEx | MM_RTKN. |
| Genevestigator | Q8C6B2. |
| GermOnline | ENSMUSG00000034930. Mus musculus. |
Family and domain databases | |
| InterPro | IPR011072. HR1_rho-bd. IPR011993. PH_type. IPR001849. Pleckstrin_homology. [Graphical view] |
| Gene3D | G3DSA:2.30.29.30. PH_type. 1 hit. |
| Pfam | PF02185. HR1. 1 hit. [Graphical view] |
| SMART | SM00742. Hr1. 1 hit. SM00233. PH. 1 hit. [Graphical view] |
| PROSITE | PS50003. PH_DOMAIN. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 297673. |
| SOURCE | Search... |
Entry information
| Entry name | RTKN_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8C6B2 Secondary accession number(s): E9QM24, Q61192, Q8VIG7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with