Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rhotekin

Gene

Rtkn

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Mediates Rho signaling to activate NF-kappa-B and may confer increased resistance to apoptosis to cells in gastric tumorigenesis. May play a novel role in the organization of septin structures (By similarity).By similarity

GO - Molecular functioni

  • GTPase inhibitor activity Source: UniProtKB
  • GTP binding Source: UniProtKB-KW
  • GTP-Rho binding Source: UniProtKB
  • Rho GTPase binding Source: MGI

GO - Biological processi

Keywordsi

Biological processApoptosis
LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-MMU-5666185. RHO GTPases Activate Rhotekin and Rhophilins.

Names & Taxonomyi

Protein namesi
Recommended name:
Rhotekin
Gene namesi
Name:RtknImported
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:107371. Rtkn.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002339411 – 564RhotekinAdd BLAST564

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei14Omega-N-methylarginineBy similarity1
Modified residuei30PhosphoserineBy similarity1
Modified residuei106PhosphoserineBy similarity1
Modified residuei230Asymmetric dimethylarginineCombined sources1
Modified residuei232PhosphoserineBy similarity1
Modified residuei520PhosphoserineBy similarity1
Modified residuei529PhosphoserineBy similarity1
Modified residuei544PhosphoserineBy similarity1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

PaxDbiQ8C6B2.
PeptideAtlasiQ8C6B2.
PRIDEiQ8C6B2.

PTM databases

iPTMnetiQ8C6B2.
PhosphoSitePlusiQ8C6B2.

Expressioni

Tissue specificityi

Abundantly expressed in brain and kidney. Weakly expressed in lung, testis, skeletal muscle, heart and thymus.1 Publication

Gene expression databases

BgeeiENSMUSG00000034930.
CleanExiMM_RTKN.
ExpressionAtlasiQ8C6B2. baseline and differential.
GenevisibleiQ8C6B2. MM.

Interactioni

Subunit structurei

Interacts via its C-terminal region with the TAX1BP3 PDZ domain. This interaction facilitates Rho-mediated activation of the c-Fos serum response element (SRE). Interacts with SEPT9 (By similarity). Specifically binds to GTP-bound RHOA, RHOB and RHOC and inhibits their GTPase activity.By similarity1 Publication

Binary interactionsi

Show more details

GO - Molecular functioni

  • GTP-Rho binding Source: UniProtKB
  • Rho GTPase binding Source: MGI

Protein-protein interaction databases

BioGridi203032. 3 interactors.
DIPiDIP-29983N.
IntActiQ8C6B2. 5 interactors.
MINTiMINT-1791510.
STRINGi10090.ENSMUSP00000065571.

Structurei

3D structure databases

ProteinModelPortaliQ8C6B2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati36 – 99REMSequence analysisAdd BLAST64
Domaini309 – 416PHSequence analysisAdd BLAST108

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi479 – 545Pro-richSequence analysisAdd BLAST67

Phylogenomic databases

eggNOGiENOG410IIHF. Eukaryota.
ENOG410ZX8Y. LUCA.
GeneTreeiENSGT00390000000104.
HOGENOMiHOG000015094.
HOVERGENiHBG059480.
InParanoidiQ8C6B2.
OMAiNKETRVR.
OrthoDBiEOG091G09OJ.
TreeFamiTF331476.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiView protein in InterPro
IPR012966. AHD.
IPR011072. HR1_rho-bd.
IPR011993. PH-like_dom_sf.
IPR001849. PH_domain.
IPR030471. RTKN.
PANTHERiPTHR21538:SF19. PTHR21538:SF19. 1 hit.
PfamiView protein in Pfam
PF08174. Anillin. 1 hit.
SMARTiView protein in SMART
SM00742. Hr1. 1 hit.
SM00233. PH. 1 hit.
SUPFAMiSSF50729. SSF50729. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q8C6B2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFSRNHRSRI TVARGSALEM EFKRGRFRLS FFSESPEDTE LQRKLDHEIR
60 70 80 90 100
MRDGACKLLA ACSQREQALE ATKSLLVCNS RILSYMGELQ RRKEAQVLEK
110 120 130 140 150
TGRRPSDSVQ PAQHSPCRGR VCISDLRIPL MWKDTEYFKN KGDLHRWAVF
160 170 180 190 200
LLLQIGEQIQ DTEMVLVDRT LTDISFQNNV LFAEAEPDFE LRLELYGACV
210 220 230 240 250
EEEGALAGAP KRLATKLSSS LGRSSGKRVR ASLDSAGASG NSPVLLPTPA
260 270 280 290 300
VGGPRFHLLA HTTLTLEEVQ DGFRTHDLTL TSHEENPAWL PLYGSVCCRL
310 320 330 340 350
AAQPLCMIQP TASGALRVQQ AGELQNGTLV HGVLKGTNLF CYWRSEDADT
360 370 380 390 400
GQEPLFTIVI NKETRVRAGE LEQAPEWPFT LSISNKYGDD EVTNTLQLES
410 420 430 440 450
REALQNWMEA LWQLFFDMSQ WRHCCDEVMK IETPAPRKPP QALAKQGSLY
460 470 480 490 500
HEMAIEPLDD IAAVTDILAQ REGTRLEPSP PWLAMFTDQP ALPSSCSPAS
510 520 530 540 550
VAPVPTWMQP LPWGRPRTFS LDAAPADHSL GPSRSVAPLP PQRSPKSRGF
560
YSKSQLGPWL QSPV
Note: No experimental confirmation available.Curated
Length:564
Mass (Da):63,013
Last modified:July 27, 2011 - v3
Checksum:i0934EEBF09B12A3E
GO
Isoform 21 Publication (identifier: Q8C6B2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MFSRNHRSRITVARGSALEMEFKRGRFRLSFFSESP → MQDRLRILEDLNMLYIRQMALSL

Show »
Length:551
Mass (Da):61,557
Checksum:iEA3D925FFF0FB85B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti67Q → L in BAC36222 (PubMed:16141072).Curated1
Sequence conflicti365R → G in AAH13820 (PubMed:15489334).Curated1
Sequence conflicti444A → V in AAC52605 (PubMed:8662891).Curated1
Sequence conflicti444A → V in AAH13820 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0520061 – 36MFSRN…FSESP → MQDRLRILEDLNMLYIRQMA LSL in isoform 2. 2 PublicationsAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U54638 mRNA. Translation: AAC52605.1.
AK076155 mRNA. Translation: BAC36222.1.
AC104324 Genomic DNA. No translation available.
BC013820 mRNA. Translation: AAH13820.1.
CCDSiCCDS20274.1. [Q8C6B2-2]
CCDS51817.1. [Q8C6B2-1]
RefSeqiNP_001129699.1. NM_001136227.1. [Q8C6B2-1]
NP_033132.2. NM_009106.2. [Q8C6B2-2]
NP_598396.2. NM_133641.2. [Q8C6B2-2]
UniGeneiMm.4139.

Genome annotation databases

EnsembliENSMUST00000065512; ENSMUSP00000065571; ENSMUSG00000034930. [Q8C6B2-1]
ENSMUST00000087938; ENSMUSP00000085249; ENSMUSG00000034930. [Q8C6B2-2]
ENSMUST00000121093; ENSMUSP00000112501; ENSMUSG00000034930. [Q8C6B2-2]
GeneIDi20166.
KEGGimmu:20166.
UCSCiuc009cms.2. mouse. [Q8C6B2-1]
uc009cmt.2. mouse. [Q8C6B2-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiRTKN_MOUSE
AccessioniPrimary (citable) accession number: Q8C6B2
Secondary accession number(s): E9QM24, Q61192, Q8VIG7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: July 27, 2011
Last modified: November 22, 2017
This is version 124 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot