Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Septin-10

Gene

Sept10

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Filament-forming cytoskeletal GTPase (By similarity). May play a role in cytokinesis (Potential).By similarityCurated

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei101GTP; via amide nitrogenBy similarity1
Binding sitei236GTP; via amide nitrogen and carbonyl oxygenBy similarity1
Binding sitei251GTPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi46 – 53GTPBy similarity8
Nucleotide bindingi182 – 190GTPBy similarity9

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processCell cycle, Cell division
LigandGTP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Septin-10
Gene namesi
Name:Sept10
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:1918110. Sept10.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001735391 – 452Septin-10Add BLAST452

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei414PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8C650.
PeptideAtlasiQ8C650.
PRIDEiQ8C650.

2D gel databases

REPRODUCTION-2DPAGEiIPI00606459.

PTM databases

iPTMnetiQ8C650.
PhosphoSitePlusiQ8C650.

Expressioni

Gene expression databases

CleanExiMM_SEPT10.

Interactioni

Subunit structurei

Septins polymerize into heterooligomeric protein complexes that form filaments, and can associate with cellular membranes, actin filaments and microtubules. GTPase activity is required for filament formation (By similarity).By similarity

Protein-protein interaction databases

IntActiQ8C650. 1 interactor.
STRINGi10090.ENSMUSP00000129023.

Structurei

3D structure databases

ProteinModelPortaliQ8C650.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini36 – 302Septin-type GAdd BLAST267

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG2655. Eukaryota.
COG5019. LUCA.
HOGENOMiHOG000233586.
HOVERGENiHBG065093.
InParanoidiQ8C650.
KOiK16940.
PhylomeDBiQ8C650.
TreeFamiTF101080.

Family and domain databases

CDDicd01850. CDC_Septin. 1 hit.
InterProiView protein in InterPro
IPR030379. G_SEPTIN_dom.
IPR027417. P-loop_NTPase.
IPR016491. Septin.
PANTHERiPTHR18884. PTHR18884. 1 hit.
PfamiView protein in Pfam
PF00735. Septin. 1 hit.
PIRSFiPIRSF006698. Septin. 1 hit.
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiView protein in PROSITE
PS51719. G_SEPTIN. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8C650-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASCDEIKEH PRSLSMCGHV GFESLPDQLV DRSIEQGFCF NILCVGETGI
60 70 80 90 100
GKSTLINTLF NTNFEELESS HFCPCVRLRA QTYELQESNV RLKLTIVNTV
110 120 130 140 150
GFGDQINKED SYQPIVDYID DQFEAYLQEE VKIKRALFNY HDSRIHVCLY
160 170 180 190 200
FIAPTGHSLR TLDLLTMKSL DNKVNIIPLI AKADTISKSE LQKFKMKLMN
210 220 230 240 250
ELVINGVQIY QFPTDDDTTS KINGAMNGHL PFAVVGSMDE IKVGNKMVKG
260 270 280 290 300
RQYPWGIVQV ENENHCDFVK LREMLICTNM EDLREQTHMR HYELYRRCKL
310 320 330 340 350
QEMGFVDMGP ENKPLSLQET YEAKRHEFYG ERQRKEEQMK QMFVQRVKEK
360 370 380 390 400
EAILKEAERE LQAKFEHLKR IHQEERMKLE EKRRMLEEES VAFAKKKATC
410 420 430 440 450
ELFPNQSFLA SGSSIRKDKD RKKADGASAF CDCLTAQESV RLCISSPRKD

MD
Length:452
Mass (Da):52,422
Last modified:March 1, 2003 - v1
Checksum:i8F84584555289072
GO
Isoform 2 (identifier: Q8C650-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     423-452: KADGASAFCDCLTAQESVRLCISSPRKDMD → NSNFM

Note: No experimental confirmation available.
Show »
Length:427
Mass (Da):49,815
Checksum:i861969B3A5987259
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti131V → L in AAH53752 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_014093423 – 452KADGA…RKDMD → NSNFM in isoform 2. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK076569 mRNA. Translation: BAC36397.1.
BC053752 mRNA. Translation: AAH53752.1.
CCDSiCCDS48566.1. [Q8C650-2]
RefSeqiNP_001020081.2. NM_001024910.3.
NP_001020082.1. NM_001024911.2.
UniGeneiMm.346842.
Mm.397041.

Genome annotation databases

GeneIDi103080.
KEGGimmu:103080.
UCSCiuc007fdm.1. mouse. [Q8C650-1]
uc007fdn.2. mouse. [Q8C650-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiSEP10_MOUSE
AccessioniPrimary (citable) accession number: Q8C650
Secondary accession number(s): Q7TSA5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 7, 2005
Last sequence update: March 1, 2003
Last modified: August 30, 2017
This is version 113 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families