Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Septin-10

Gene

Sept10

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Filament-forming cytoskeletal GTPase (By similarity). May play a role in cytokinesis (Potential).By similarityCurated

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei101 – 1011GTP; via amide nitrogenBy similarity
Binding sitei236 – 2361GTP; via amide nitrogen and carbonyl oxygenBy similarity
Binding sitei251 – 2511GTPBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi46 – 538GTPBy similarity
Nucleotide bindingi182 – 1909GTPBy similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Cell cycle, Cell division

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Septin-10
Gene namesi
Name:Sept10
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:1918110. Sept10.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 452452Septin-10PRO_0000173539Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei414 – 4141PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8C650.
PaxDbiQ8C650.
PeptideAtlasiQ8C650.
PRIDEiQ8C650.

2D gel databases

REPRODUCTION-2DPAGEIPI00606459.

PTM databases

iPTMnetiQ8C650.
PhosphoSiteiQ8C650.

Expressioni

Gene expression databases

BgeeiENSMUSG00000019917.
CleanExiMM_SEPT10.

Interactioni

Subunit structurei

Septins polymerize into heterooligomeric protein complexes that form filaments, and can associate with cellular membranes, actin filaments and microtubules. GTPase activity is required for filament formation (By similarity).By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000129023.

Structurei

3D structure databases

ProteinModelPortaliQ8C650.
SMRiQ8C650. Positions 16-304.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini36 – 302267Septin-type GAdd
BLAST

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG2655. Eukaryota.
COG5019. LUCA.
HOGENOMiHOG000233586.
HOVERGENiHBG065093.
InParanoidiQ8C650.
KOiK16940.
PhylomeDBiQ8C650.
TreeFamiTF101080.

Family and domain databases

CDDicd01850. CDC_Septin. 1 hit.
Gene3Di3.40.50.300. 1 hit.
InterProiIPR030379. G_SEPTIN_dom.
IPR027417. P-loop_NTPase.
IPR016491. Septin.
[Graphical view]
PANTHERiPTHR18884. PTHR18884. 1 hit.
PfamiPF00735. Septin. 1 hit.
[Graphical view]
PIRSFiPIRSF006698. Septin. 1 hit.
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS51719. G_SEPTIN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8C650-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASCDEIKEH PRSLSMCGHV GFESLPDQLV DRSIEQGFCF NILCVGETGI
60 70 80 90 100
GKSTLINTLF NTNFEELESS HFCPCVRLRA QTYELQESNV RLKLTIVNTV
110 120 130 140 150
GFGDQINKED SYQPIVDYID DQFEAYLQEE VKIKRALFNY HDSRIHVCLY
160 170 180 190 200
FIAPTGHSLR TLDLLTMKSL DNKVNIIPLI AKADTISKSE LQKFKMKLMN
210 220 230 240 250
ELVINGVQIY QFPTDDDTTS KINGAMNGHL PFAVVGSMDE IKVGNKMVKG
260 270 280 290 300
RQYPWGIVQV ENENHCDFVK LREMLICTNM EDLREQTHMR HYELYRRCKL
310 320 330 340 350
QEMGFVDMGP ENKPLSLQET YEAKRHEFYG ERQRKEEQMK QMFVQRVKEK
360 370 380 390 400
EAILKEAERE LQAKFEHLKR IHQEERMKLE EKRRMLEEES VAFAKKKATC
410 420 430 440 450
ELFPNQSFLA SGSSIRKDKD RKKADGASAF CDCLTAQESV RLCISSPRKD

MD
Length:452
Mass (Da):52,422
Last modified:March 1, 2003 - v1
Checksum:i8F84584555289072
GO
Isoform 2 (identifier: Q8C650-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     423-452: KADGASAFCDCLTAQESVRLCISSPRKDMD → NSNFM

Note: No experimental confirmation available.
Show »
Length:427
Mass (Da):49,815
Checksum:i861969B3A5987259
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti131 – 1311V → L in AAH53752 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei423 – 45230KADGA…RKDMD → NSNFM in isoform 2. 1 PublicationVSP_014093Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK076569 mRNA. Translation: BAC36397.1.
BC053752 mRNA. Translation: AAH53752.1.
CCDSiCCDS48566.1. [Q8C650-2]
RefSeqiNP_001020081.2. NM_001024910.3.
NP_001020082.1. NM_001024911.2.
UniGeneiMm.346842.
Mm.397041.

Genome annotation databases

GeneIDi103080.
KEGGimmu:103080.
UCSCiuc007fdm.1. mouse. [Q8C650-1]
uc007fdn.2. mouse. [Q8C650-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK076569 mRNA. Translation: BAC36397.1.
BC053752 mRNA. Translation: AAH53752.1.
CCDSiCCDS48566.1. [Q8C650-2]
RefSeqiNP_001020081.2. NM_001024910.3.
NP_001020082.1. NM_001024911.2.
UniGeneiMm.346842.
Mm.397041.

3D structure databases

ProteinModelPortaliQ8C650.
SMRiQ8C650. Positions 16-304.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000129023.

PTM databases

iPTMnetiQ8C650.
PhosphoSiteiQ8C650.

2D gel databases

REPRODUCTION-2DPAGEIPI00606459.

Proteomic databases

MaxQBiQ8C650.
PaxDbiQ8C650.
PeptideAtlasiQ8C650.
PRIDEiQ8C650.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi103080.
KEGGimmu:103080.
UCSCiuc007fdm.1. mouse. [Q8C650-1]
uc007fdn.2. mouse. [Q8C650-2]

Organism-specific databases

CTDi151011.
MGIiMGI:1918110. Sept10.

Phylogenomic databases

eggNOGiKOG2655. Eukaryota.
COG5019. LUCA.
HOGENOMiHOG000233586.
HOVERGENiHBG065093.
InParanoidiQ8C650.
KOiK16940.
PhylomeDBiQ8C650.
TreeFamiTF101080.

Miscellaneous databases

PROiQ8C650.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000019917.
CleanExiMM_SEPT10.

Family and domain databases

CDDicd01850. CDC_Septin. 1 hit.
Gene3Di3.40.50.300. 1 hit.
InterProiIPR030379. G_SEPTIN_dom.
IPR027417. P-loop_NTPase.
IPR016491. Septin.
[Graphical view]
PANTHERiPTHR18884. PTHR18884. 1 hit.
PfamiPF00735. Septin. 1 hit.
[Graphical view]
PIRSFiPIRSF006698. Septin. 1 hit.
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS51719. G_SEPTIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSEP10_MOUSE
AccessioniPrimary (citable) accession number: Q8C650
Secondary accession number(s): Q7TSA5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 7, 2005
Last sequence update: March 1, 2003
Last modified: September 7, 2016
This is version 106 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.