Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Spermatogenesis-associated protein 16

Gene

Spata16

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Involved in the formation of sperm acrosome, which implicated its potential role in spermatogenesis and sperm-egg fusion.1 Publication

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, Spermatogenesis

Names & Taxonomyi

Protein namesi
Recommended name:
Spermatogenesis-associated protein 16
Gene namesi
Name:Spata16
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 3

Organism-specific databases

MGIiMGI:1918112. Spata16.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasmic vesicle, Golgi apparatus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 571571Spermatogenesis-associated protein 16PRO_0000315832Add
BLAST

Proteomic databases

PaxDbiQ8C636.
PRIDEiQ8C636.

PTM databases

iPTMnetiQ8C636.
PhosphoSiteiQ8C636.

Expressioni

Tissue specificityi

Expressed in spermatocytes and round and elongated spermatids in the seminiferous tubules.2 Publications

Gene expression databases

BgeeiQ8C636.
CleanExiMM_SPATA16.
GenevisibleiQ8C636. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000043378.

Structurei

3D structure databases

ProteinModelPortaliQ8C636.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the SPATA16 family.Curated

Phylogenomic databases

eggNOGiENOG410IIVM. Eukaryota.
ENOG410YCKT. LUCA.
GeneTreeiENSGT00390000015332.
HOGENOMiHOG000154398.
HOVERGENiHBG101715.
InParanoidiQ8C636.
OMAiDNQLITM.
OrthoDBiEOG783MTX.
TreeFamiTF335624.

Family and domain databases

Gene3Di1.25.40.10. 1 hit.
InterProiIPR029161. SPATA16.
IPR011990. TPR-like_helical_dom.
[Graphical view]
PfamiPF15015. NYD-SP12_N. 1 hit.
[Graphical view]
SUPFAMiSSF48452. SSF48452. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8C636-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDSGKSRSLE TTVKRVYRDL LLPKINTSKK MSTLTNSPSS LEGTPGIKKN
60 70 80 90 100
SGEMQAEASA ERVKLTKSIK EKQNNELEKV ALKRKADSEE KLVGKKEAKI
110 120 130 140 150
MELDNQLVTT VPLPHIPLKN IMDVEMKLVY VDEEDVSYEF AQPNMCLGLQ
160 170 180 190 200
ATGQTATTMP PASPRDLTTL PQIDKWLQVA LKDASSCYRQ KKYAVAAGQF
210 220 230 240 250
RTALELCSKG AALGKPFEAH AEDIASIASF IETKLVTCYL RMRKPDLALN
260 270 280 290 300
HAHRSIVLNP AYFRNHLRQA AVFRCLERYS EAARSAMIAD YMFWLCGGSE
310 320 330 340 350
HSVSKLIKLY WQAMIEEAIT RAEAFSVMYT PFATRIKPEN IEKVKEVFMR
360 370 380 390 400
THPTYVDCIY TDTQGLHVLP QTADWSCFPP QQYLLTLGFK NKEDGKFLEK
410 420 430 440 450
VSSRKLPTYT EHKTPFSPLT REDTVRHMET VGKRILPILD FIRSTQLNGN
460 470 480 490 500
FHACSGVMEK LHYASLLSRL QRVKEQAQVI NQAMAELATV PYLQDISQQE
510 520 530 540 550
AELLQSLMAD AMDTLEGKKS DKERVWNTIQ KVGRIEDFLY QLEDSFLKTK
560 570
KLRTARRQKT KMKRLQTVQQ N
Length:571
Mass (Da):65,006
Last modified:March 1, 2003 - v1
Checksum:i0B8DF528389EF26E
GO
Isoform 2 (identifier: Q8C636-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     533-571: GRIEDFLYQLEDSFLKTKKLRTARRQKTKMKRLQTVQQN → KF

Show »
Length:534
Mass (Da):60,502
Checksum:iA74A5D8A930E19B0
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei533 – 57139GRIED…TVQQN → KF in isoform 2. 2 PublicationsVSP_030726Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK076628 mRNA. Translation: BAC36421.1.
AK014869 mRNA. Translation: BAB29592.1.
BC100443 mRNA. Translation: AAI00444.1.
BC132205 mRNA. Translation: AAI32206.1.
BC132539 mRNA. Translation: AAI32540.1.
CCDSiCCDS17269.1. [Q8C636-1]
CCDS38403.1. [Q8C636-2]
RefSeqiNP_081859.1. NM_027583.3. [Q8C636-2]
NP_083426.1. NM_029150.4. [Q8C636-1]
UniGeneiMm.330943.

Genome annotation databases

EnsembliENSMUST00000047005; ENSMUSP00000043378; ENSMUSG00000039335. [Q8C636-1]
ENSMUST00000108305; ENSMUSP00000103941; ENSMUSG00000039335. [Q8C636-2]
GeneIDi70862.
KEGGimmu:70862.
UCSCiuc008otf.2. mouse. [Q8C636-2]
uc008otg.1. mouse. [Q8C636-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK076628 mRNA. Translation: BAC36421.1.
AK014869 mRNA. Translation: BAB29592.1.
BC100443 mRNA. Translation: AAI00444.1.
BC132205 mRNA. Translation: AAI32206.1.
BC132539 mRNA. Translation: AAI32540.1.
CCDSiCCDS17269.1. [Q8C636-1]
CCDS38403.1. [Q8C636-2]
RefSeqiNP_081859.1. NM_027583.3. [Q8C636-2]
NP_083426.1. NM_029150.4. [Q8C636-1]
UniGeneiMm.330943.

3D structure databases

ProteinModelPortaliQ8C636.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000043378.

PTM databases

iPTMnetiQ8C636.
PhosphoSiteiQ8C636.

Proteomic databases

PaxDbiQ8C636.
PRIDEiQ8C636.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000047005; ENSMUSP00000043378; ENSMUSG00000039335. [Q8C636-1]
ENSMUST00000108305; ENSMUSP00000103941; ENSMUSG00000039335. [Q8C636-2]
GeneIDi70862.
KEGGimmu:70862.
UCSCiuc008otf.2. mouse. [Q8C636-2]
uc008otg.1. mouse. [Q8C636-1]

Organism-specific databases

CTDi83893.
MGIiMGI:1918112. Spata16.

Phylogenomic databases

eggNOGiENOG410IIVM. Eukaryota.
ENOG410YCKT. LUCA.
GeneTreeiENSGT00390000015332.
HOGENOMiHOG000154398.
HOVERGENiHBG101715.
InParanoidiQ8C636.
OMAiDNQLITM.
OrthoDBiEOG783MTX.
TreeFamiTF335624.

Miscellaneous databases

ChiTaRSiSpata16. mouse.
PROiQ8C636.
SOURCEiSearch...

Gene expression databases

BgeeiQ8C636.
CleanExiMM_SPATA16.
GenevisibleiQ8C636. MM.

Family and domain databases

Gene3Di1.25.40.10. 1 hit.
InterProiIPR029161. SPATA16.
IPR011990. TPR-like_helical_dom.
[Graphical view]
PfamiPF15015. NYD-SP12_N. 1 hit.
[Graphical view]
SUPFAMiSSF48452. SSF48452. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
  3. "Identification and characterization of a novel human testis-specific Golgi protein, NYD-SP12."
    Xu M., Xiao J., Chen J., Li J., Yin L., Zhu H., Zhou Z., Sha J.
    Mol. Hum. Reprod. 9:9-17(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
  4. "Gene functional research using polyethylenimine-mediated in vivo gene transfection into mouse spermatogenic cells."
    Lu L., Lin M., Xu M., Zhou Z.-M., Sha J.
    Asian J. Androl. 8:53-59(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiSPT16_MOUSE
AccessioniPrimary (citable) accession number: Q8C636
Secondary accession number(s): Q9D5W9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: March 1, 2003
Last modified: June 8, 2016
This is version 95 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.