Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centromere protein X

Gene

Cenpx

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

DNA-binding component of the Fanconi anemia (FA) core complex. Required for the normal activation of the FA pathway, leading to monoubiquitination of the FANCI-FANCD2 complex in response to DNA damage, cellular resistance to DNA cross-linking drugs, and prevention of chromosomal breakage. In complex with CENPS (MHF heterodimer), crucial cofactor for FANCM in both binding and ATP-dependent remodeling of DNA. Stabilizes FANCM. In complex with CENPS and FANCM (but not other FANC proteins), rapidly recruited to blocked forks and promotes gene conversion at blocked replication forks. In complex with CENPS, CENPT and CENPW (CENP-T-W-S-X heterotetramer), involved in the formation of a functional kinetochore outer plate, which is essential for kinetochore-microtubule attachment and faithful mitotic progression. As a component of MHF and CENP-T-W-S-X complexes, binds DNA and bends it to form a nucleosome-like structure. DNA-binding function is fulfilled in the presence of CENPS, with the following preference for DNA substates: Holliday junction > double-stranded > splay arm > single-stranded. Does not bind DNA on its own.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
Biological processCell cycle, Cell division, DNA damage, DNA repair, Mitosis

Enzyme and pathway databases

ReactomeiR-MMU-606279. Deposition of new CENPA-containing nucleosomes at the centromere.
R-MMU-6783310. Fanconi Anemia Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Centromere protein X
Short name:
CENP-X
Alternative name(s):
FANCM-interacting histone fold protein 2
Fanconi anemia-associated polypeptide of 10 kDa
Immediate-early-response protein D9
Retinoic acid-inducible gene D9 protein
Stimulated by retinoic acid gene 13 protein homolog
Gene namesi
Name:Cenpx
Synonyms:Faap10, Mhf2, Stra13
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:894324. Cenpx.

Subcellular locationi

  • Nucleus By similarity
  • Chromosomecentromere By similarity
  • Chromosomecentromerekinetochore By similarity

  • Note: Assembly of CENPS and CENPX and its partner subunits CENPT and CENPW at centromeres occurs through a dynamic exchange mechanism. Although exchange is continuous in the cell cycle, de novo assembly starts principally during mid-late S phase and is complete by G2. CENPX being less stably bound at the kinetochore than CENPS.By similarity

GO - Cellular componenti

Keywords - Cellular componenti

Centromere, Chromosome, Kinetochore, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003371811 – 78Centromere protein XAdd BLAST78

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

PaxDbiQ8C4X1.
PeptideAtlasiQ8C4X1.
PRIDEiQ8C4X1.

PTM databases

PhosphoSitePlusiQ8C4X1.

Expressioni

Inductioni

By retinoic acid.1 Publication

Gene expression databases

BgeeiENSMUSG00000025144.
CleanExiMM_STRA13.
ExpressionAtlasiQ8C4X1. baseline and differential.
GenevisibleiQ8C4X1. MM.

Interactioni

Subunit structurei

Heterodimer with CENPX, sometimes called MHF; this interaction stabilizes both partners. MHF heterodimers can assemble to form tetrameric structures. MHF also coassemble with CENPT-CENPW heterodimers at centromeres to form the tetrameric CENP-T-W-S-X complex. Forms a discrete complex with FANCM and CENPX, called FANCM-MHF; this interaction, probably mediated by direct binding between CENPS and FANCM, leads to synergistic activation of double-stranded DNA binding and strongly stimulates FANCM-mediated DNA remodeling. Recruited by FANCM to the Fanconi anemia (FA) core complex, which consists of CENPS, CENPX, FANCA, FANCB, FANCC, FANCE, FANCF, FANCG, FANCL, FANCM, FAAP24 and FAAP100. The FA core complex associates with Bloom syndrome (BLM) complex, which consists of at least BLM, DNA topoisomerase 3-alpha (TOP3A), RMI1/BLAP75, RPA1/RPA70 and RPA2/RPA32. The super complex between FA and BLM is called BRAFT.By similarity

Protein-protein interaction databases

BioGridi203553. 1 interactor.
STRINGi10090.ENSMUSP00000050335.

Structurei

3D structure databases

ProteinModelPortaliQ8C4X1.
SMRiQ8C4X1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the CENPX family.Curated

Phylogenomic databases

eggNOGiENOG410J30M. Eukaryota.
ENOG410XYKN. LUCA.
GeneTreeiENSGT00390000002725.
HOGENOMiHOG000231242.
InParanoidiQ8C4X1.
KOiK15360.
TreeFamiTF330764.

Family and domain databases

InterProiView protein in InterPro
IPR018552. CENP-X.
PfamiView protein in Pfam
PF09415. CENP-X. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8C4X1-1) [UniParc]FASTAAdd to basket
Also known as: Variant 2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEGNSGFRKE LVSRLLHLHF RDCKTKVSGD ALQLMAEFLR IFVLEAAVRG
60 70
VWQAQAEDLD VVEVDQLEKV LPQLLLDF
Length:78
Mass (Da):8,926
Last modified:March 1, 2003 - v1
Checksum:i4FF0546DDC3F3856
GO
Isoform 2 (identifier: Q8C4X1-2) [UniParc]FASTAAdd to basket
Also known as: Variant 3

The sequence of this isoform differs from the canonical sequence as follows:
     9-9: K → KAIHFEGRGC...DAWPICRHHL

Show »
Length:169
Mass (Da):18,999
Checksum:i85B4AEE45C3E644C
GO
Isoform 3 (identifier: Q8C4X1-3) [UniParc]FASTAAdd to basket
Also known as: Variant 1

The sequence of this isoform differs from the canonical sequence as follows:
     9-9: K → KALDSPSHLHLTNYHQPFSSQAIPDAWSICRHHL

Note: No experimental confirmation available.
Show »
Length:111
Mass (Da):12,689
Checksum:i7E2ECB4FD3BFCCF7
GO
Isoform 4 (identifier: Q8C4X1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     26-26: K → KGLGHQWGGEYVGHREGGCPMTPPPSPFPP

Show »
Length:107
Mass (Da):11,954
Checksum:i762927FED5AE3BCE
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti19H → N in AAB53636 (PubMed:8839844).Curated1
Sequence conflicti43V → G in AAB53636 (PubMed:8839844).Curated1
Sequence conflicti56A → V in AAB53636 (PubMed:8839844).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0339509K → KAIHFEGRGCLSLPTFCLSL VVPHSVLDYANLSGLGFTHC TDARGLLMAHLWCSHGIPRP LDSPSHLHLTNYHQPFSSQA IPDAWPICRHHL in isoform 2. 1 Publication1
Alternative sequenceiVSP_0339519K → KALDSPSHLHLTNYHQPFSS QAIPDAWSICRHHL in isoform 3. 1 Publication1
Alternative sequenceiVSP_03395226K → KGLGHQWGGEYVGHREGGCP MTPPPSPFPP in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U95003 mRNA. Translation: AAB53635.1.
U95004 mRNA. Translation: AAB53636.1.
U95005 mRNA. Translation: AAB53637.1.
AK076181 mRNA. Translation: BAC36237.1.
AK080500 mRNA. Translation: BAC37933.1.
AK170126 mRNA. Translation: BAE41581.1.
AL663030 Genomic DNA. Translation: CAM27116.1.
AL663030 Genomic DNA. Translation: CAM27117.1.
CCDSiCCDS49009.1. [Q8C4X1-1]
CCDS83948.1. [Q8C4X1-4]
RefSeqiNP_001334540.1. NM_001347611.1. [Q8C4X1-4]
NP_057874.2. NM_016665.2. [Q8C4X1-1]
UniGeneiMm.259716.

Genome annotation databases

EnsembliENSMUST00000026137; ENSMUSP00000026137; ENSMUSG00000025144. [Q8C4X1-4]
ENSMUST00000055424; ENSMUSP00000050335; ENSMUSG00000025144. [Q8C4X1-1]
GeneIDi20892.
KEGGimmu:20892.
UCSCiuc007muc.1. mouse. [Q8C4X1-1]
uc029rqh.1. mouse. [Q8C4X1-4]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.

Entry informationi

Entry nameiCENPX_MOUSE
AccessioniPrimary (citable) accession number: Q8C4X1
Secondary accession number(s): A2AC08
, O08693, O08694, O08695, Q8BPD7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: March 1, 2003
Last modified: June 7, 2017
This is version 114 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families