Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centromere protein X

Gene

Cenpx

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

DNA-binding component of the Fanconi anemia (FA) core complex. Required for the normal activation of the FA pathway, leading to monoubiquitination of the FANCI-FANCD2 complex in response to DNA damage, cellular resistance to DNA cross-linking drugs, and prevention of chromosomal breakage. In complex with CENPS (MHF heterodimer), crucial cofactor for FANCM in both binding and ATP-dependent remodeling of DNA. Stabilizes FANCM. In complex with CENPS and FANCM (but not other FANC proteins), rapidly recruited to blocked forks and promotes gene conversion at blocked replication forks. In complex with CENPS, CENPT and CENPW (CENP-T-W-S-X heterotetramer), involved in the formation of a functional kinetochore outer plate, which is essential for kinetochore-microtubule attachment and faithful mitotic progression. As a component of MHF and CENP-T-W-S-X complexes, binds DNA and bends it to form a nucleosome-like structure. DNA-binding function is fulfilled in the presence of CENPS, with the following preference for DNA substates: Holliday junction > double-stranded > splay arm > single-stranded. Does not bind DNA on its own.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
Biological processCell cycle, Cell division, DNA damage, DNA repair, Mitosis

Enzyme and pathway databases

ReactomeiR-MMU-606279 Deposition of new CENPA-containing nucleosomes at the centromere
R-MMU-6783310 Fanconi Anemia Pathway

Names & Taxonomyi

Protein namesi
Recommended name:
Centromere protein X
Short name:
CENP-X
Alternative name(s):
FANCM-interacting histone fold protein 2
Fanconi anemia-associated polypeptide of 10 kDa
Immediate-early-response protein D9
Retinoic acid-inducible gene D9 protein
Stimulated by retinoic acid gene 13 protein homolog
Gene namesi
Name:Cenpx
Synonyms:Faap10, Mhf2, Stra13
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:894324 Cenpx

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Centromere, Chromosome, Kinetochore, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003371811 – 78Centromere protein XAdd BLAST78

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

PaxDbiQ8C4X1
PeptideAtlasiQ8C4X1
PRIDEiQ8C4X1

PTM databases

PhosphoSitePlusiQ8C4X1

Expressioni

Inductioni

By retinoic acid.1 Publication

Gene expression databases

BgeeiENSMUSG00000025144
CleanExiMM_STRA13
ExpressionAtlasiQ8C4X1 baseline and differential
GenevisibleiQ8C4X1 MM

Interactioni

Subunit structurei

Heterodimer with CENPX, sometimes called MHF; this interaction stabilizes both partners. MHF heterodimers can assemble to form tetrameric structures. MHF also coassemble with CENPT-CENPW heterodimers at centromeres to form the tetrameric CENP-T-W-S-X complex. Forms a discrete complex with FANCM and CENPX, called FANCM-MHF; this interaction, probably mediated by direct binding between CENPS and FANCM, leads to synergistic activation of double-stranded DNA binding and strongly stimulates FANCM-mediated DNA remodeling. Recruited by FANCM to the Fanconi anemia (FA) core complex, which consists of CENPS, CENPX, FANCA, FANCB, FANCC, FANCE, FANCF, FANCG, FANCL, FANCM, FAAP24 and FAAP100. The FA core complex associates with Bloom syndrome (BLM) complex, which consists of at least BLM, DNA topoisomerase 3-alpha (TOP3A), RMI1/BLAP75, RPA1/RPA70 and RPA2/RPA32. The super complex between FA and BLM is called BRAFT.By similarity

Protein-protein interaction databases

BioGridi203553, 1 interactor
STRINGi10090.ENSMUSP00000050335

Structurei

3D structure databases

ProteinModelPortaliQ8C4X1
SMRiQ8C4X1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the CENP-X/MHF2 family.Curated

Phylogenomic databases

eggNOGiENOG410J30M Eukaryota
ENOG410XYKN LUCA
GeneTreeiENSGT00390000002725
HOGENOMiHOG000231242
InParanoidiQ8C4X1
KOiK15360
TreeFamiTF330764

Family and domain databases

InterProiView protein in InterPro
IPR018552 CENP-X
PANTHERiPTHR28680 PTHR28680, 1 hit
PfamiView protein in Pfam
PF09415 CENP-X, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8C4X1-1) [UniParc]FASTAAdd to basket
Also known as: Variant 2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEGNSGFRKE LVSRLLHLHF RDCKTKVSGD ALQLMAEFLR IFVLEAAVRG
60 70
VWQAQAEDLD VVEVDQLEKV LPQLLLDF
Length:78
Mass (Da):8,926
Last modified:March 1, 2003 - v1
Checksum:i4FF0546DDC3F3856
GO
Isoform 2 (identifier: Q8C4X1-2) [UniParc]FASTAAdd to basket
Also known as: Variant 3

The sequence of this isoform differs from the canonical sequence as follows:
     9-9: K → KAIHFEGRGC...DAWPICRHHL

Show »
Length:169
Mass (Da):18,999
Checksum:i85B4AEE45C3E644C
GO
Isoform 3 (identifier: Q8C4X1-3) [UniParc]FASTAAdd to basket
Also known as: Variant 1

The sequence of this isoform differs from the canonical sequence as follows:
     9-9: K → KALDSPSHLHLTNYHQPFSSQAIPDAWSICRHHL

Note: No experimental confirmation available.
Show »
Length:111
Mass (Da):12,689
Checksum:i7E2ECB4FD3BFCCF7
GO
Isoform 4 (identifier: Q8C4X1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     26-26: K → KGLGHQWGGEYVGHREGGCPMTPPPSPFPP

Show »
Length:107
Mass (Da):11,954
Checksum:i762927FED5AE3BCE
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti19H → N in AAB53636 (PubMed:8839844).Curated1
Sequence conflicti43V → G in AAB53636 (PubMed:8839844).Curated1
Sequence conflicti56A → V in AAB53636 (PubMed:8839844).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0339509K → KAIHFEGRGCLSLPTFCLSL VVPHSVLDYANLSGLGFTHC TDARGLLMAHLWCSHGIPRP LDSPSHLHLTNYHQPFSSQA IPDAWPICRHHL in isoform 2. 1 Publication1
Alternative sequenceiVSP_0339519K → KALDSPSHLHLTNYHQPFSS QAIPDAWSICRHHL in isoform 3. 1 Publication1
Alternative sequenceiVSP_03395226K → KGLGHQWGGEYVGHREGGCP MTPPPSPFPP in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U95003 mRNA Translation: AAB53635.1
U95004 mRNA Translation: AAB53636.1
U95005 mRNA Translation: AAB53637.1
AK076181 mRNA Translation: BAC36237.1
AK080500 mRNA Translation: BAC37933.1
AK170126 mRNA Translation: BAE41581.1
AL663030 Genomic DNA No translation available.
CCDSiCCDS49009.1 [Q8C4X1-1]
CCDS83948.1 [Q8C4X1-4]
RefSeqiNP_001334540.1, NM_001347611.1 [Q8C4X1-4]
NP_057874.2, NM_016665.2 [Q8C4X1-1]
UniGeneiMm.259716

Genome annotation databases

EnsembliENSMUST00000026137; ENSMUSP00000026137; ENSMUSG00000025144 [Q8C4X1-4]
ENSMUST00000055424; ENSMUSP00000050335; ENSMUSG00000025144 [Q8C4X1-1]
GeneIDi20892
KEGGimmu:20892
UCSCiuc007muc.1 mouse [Q8C4X1-1]
uc029rqh.1 mouse [Q8C4X1-4]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCENPX_MOUSE
AccessioniPrimary (citable) accession number: Q8C4X1
Secondary accession number(s): A2AC08
, O08693, O08694, O08695, Q8BPD7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: March 1, 2003
Last modified: May 23, 2018
This is version 117 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health