Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho GTPase-activating protein 24

Gene

Arhgap24

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Rho GTPase-activating protein involved in cell polarity, cell morphology and cytoskeletal organization. Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state. Controls actin remodeling by inactivating Rac downstream of Rho leading to suppress leading edge protrusion and promotes cell retraction to achieve cellular polarity. Able to suppress RAC1 and CDC42 activity in vitro. Overexpression induces cell rounding with partial or complete disruption of actin stress fibers and formation of membrane ruffles, lamellipodia, and filopodia. Isoform 2 is a vascular cell-specific GAP involved in modulation of angiogenesis (By similarity).By similarity

GO - Molecular functioni

  • GTPase activator activity Source: MGI

GO - Biological processi

  • activation of GTPase activity Source: MGI
  • angiogenesis Source: UniProtKB-KW
  • cell differentiation Source: UniProtKB-KW
  • negative regulation of Rac protein signal transduction Source: MGI
  • negative regulation of ruffle assembly Source: MGI
  • signal transduction Source: InterPro
  • wound healing, spreading of epidermal cells Source: MGI

Keywordsi

Molecular functionDevelopmental protein, GTPase activation
Biological processAngiogenesis, Differentiation

Enzyme and pathway databases

ReactomeiR-MMU-194840 Rho GTPase cycle

Names & Taxonomyi

Protein namesi
Recommended name:
Rho GTPase-activating protein 24
Alternative name(s):
Rho-type GTPase-activating protein 24
Gene namesi
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi

Organism-specific databases

MGIiMGI:1922647 Arhgap24

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Cytoskeleton

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002804741 – 747Rho GTPase-activating protein 24Add BLAST747

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei368PhosphoserineBy similarity1
Modified residuei390PhosphoserineCombined sources1
Modified residuei395PhosphoserineCombined sources1
Modified residuei397PhosphoserineCombined sources1
Modified residuei401PhosphoserineBy similarity1
Modified residuei412PhosphoserineBy similarity1
Modified residuei414PhosphoserineBy similarity1
Modified residuei436PhosphoserineBy similarity1
Modified residuei451PhosphothreonineBy similarity1
Modified residuei494PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated by ROCK, leading to activate the RacGAP activity.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8C4V1
PRIDEiQ8C4V1

PTM databases

iPTMnetiQ8C4V1
PhosphoSitePlusiQ8C4V1

Expressioni

Gene expression databases

BgeeiENSMUSG00000057315
CleanExiMM_ARHGAP24
ExpressionAtlasiQ8C4V1 baseline and differential
GenevisibleiQ8C4V1 MM

Interactioni

Subunit structurei

Interacts with FLNA.By similarity

Protein-protein interaction databases

BioGridi231132, 1 interactor
IntActiQ8C4V1, 1 interactor
STRINGi10090.ENSMUSP00000092138

Structurei

3D structure databases

ProteinModelPortaliQ8C4V1
SMRiQ8C4V1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini17 – 123PHPROSITE-ProRule annotationAdd BLAST107
Domaini133 – 327Rho-GAPPROSITE-ProRule annotationAdd BLAST195

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili648 – 728Sequence analysisAdd BLAST81

Domaini

The coiled coil domain mediates the interaction with FLNA leading to its recruitment to lamellae.By similarity

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG4270 Eukaryota
ENOG410XRR2 LUCA
GeneTreeiENSGT00760000118863
HOGENOMiHOG000232151
HOVERGENiHBG058875
InParanoidiQ8C4V1
KOiK20642
PhylomeDBiQ8C4V1

Family and domain databases

Gene3Di1.10.555.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR008936 Rho_GTPase_activation_prot
IPR000198 RhoGAP_dom
PfamiView protein in Pfam
PF00169 PH, 1 hit
PF00620 RhoGAP, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00324 RhoGAP, 1 hit
SUPFAMiSSF48350 SSF48350, 1 hit
PROSITEiView protein in PROSITE
PS50003 PH_DOMAIN, 1 hit
PS50238 RHOGAP, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8C4V1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEERCESTES PQGQGRKNTK CGWLRKQGGF VKTWHTRWFV LKGDQLYYFK
60 70 80 90 100
DEDETKPLGT IFLHGNKVIE HPCNEENPGK FLFDVVPGGE RDRMTANHES
110 120 130 140 150
YLLMASTQND MEDWVKSIRR VIWGPFGGGI FGQKLEDTVR YEKRYGNRLA
160 170 180 190 200
PMLVEQCVDF IRQRGLKEEG LFRLPGQANL VKELQDAFDC GEKPSFDSNT
210 220 230 240 250
DVHTVASLLK LYLRELPEPV VPYAKYEDFL SCATLLSKEE EAGVKELMKQ
260 270 280 290 300
VKSLPVVNYN LLKYICRFLD EVQSYSGVNK MSAQNLATVF GPNILRPKVE
310 320 330 340 350
DPLTIMEGTV VVQQLMSVMI SKHDRLFPKD TEPQSKPQDG PNSNNNDGHK
360 370 380 390 400
KATMGQLQNK ENNNTKESPV RRCSWDKPES PQRSSVDNGS PTALSGSKTN
410 420 430 440 450
SPRNSIHKLD ISRSPPLMVK KNPAFNKGSG IVTNGSFSSS NAEGVEKPQT
460 470 480 490 500
TPNGSLQARR TSSLKSSGTK MGTHSVQNGT VRMGILNTDT LGNSLNGRSM
510 520 530 540 550
SWLPNGYVTL RDNKQKEPAG ESGQHNRLST YDNVHQQFSS MSLDDKHSVD
560 570 580 590 600
SATWSTSSCE ISLPENSNSC RSSTTTCPEQ DFYVGNFEDP VLDGPPQDDL
610 620 630 640 650
SHPGDYENKS DRRSVGGRSS RATSSSDNSE TFVGNTSSNH SALHSLVSSL
660 670 680 690 700
KQEMTKQKIE YESRIKSLEQ RNLTLETEML SLHDELDQER KKFTMIEIKM
710 720 730 740
RNAERAKEDA EKRNDMLQKE MEQFFSTFGD LTVEPRRSER GNTIWIQ
Length:747
Mass (Da):84,100
Last modified:March 20, 2007 - v2
Checksum:i769982BA6B90D425
GO
Isoform 2 (identifier: Q8C4V1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-91: Missing.
     92-128: DRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGG → MPEDRNSGGRPSGALASTPFIPKTTYRRIKRCFSFRK

Show »
Length:656
Mass (Da):73,447
Checksum:i1DD35121A4007443
GO
Isoform 3 (identifier: Q8C4V1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-93: Missing.

Show »
Length:654
Mass (Da):73,259
Checksum:i7AA6C305CA3D7952
GO

Sequence cautioni

The sequence BAC30402 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti183E → K in BAC38105 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0237191 – 93Missing in isoform 3. 1 PublicationAdd BLAST93
Alternative sequenceiVSP_0237201 – 91Missing in isoform 2. 1 PublicationAdd BLAST91
Alternative sequenceiVSP_02372192 – 128DRMTA…GPFGG → MPEDRNSGGRPSGALASTPF IPKTTYRRIKRCFSFRK in isoform 2. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK039617 mRNA Translation: BAC30402.1 Different initiation.
AK080986 mRNA Translation: BAC38105.1
BC023344 mRNA Translation: AAH23344.1
BC025502 mRNA Translation: AAH25502.1
BC027070 mRNA Translation: AAH27070.1
CCDSiCCDS19474.1 [Q8C4V1-1]
CCDS19475.1 [Q8C4V1-3]
RefSeqiNP_001273397.1, NM_001286468.1 [Q8C4V1-3]
NP_083546.2, NM_029270.2
NP_666273.1, NM_146161.3 [Q8C4V1-3]
XP_006534954.1, XM_006534891.3 [Q8C4V1-3]
XP_011247736.1, XM_011249434.2 [Q8C4V1-3]
UniGeneiMm.440191

Genome annotation databases

EnsembliENSMUST00000073302; ENSMUSP00000073028; ENSMUSG00000057315 [Q8C4V1-3]
ENSMUST00000112852; ENSMUSP00000108473; ENSMUSG00000057315 [Q8C4V1-3]
ENSMUST00000112853; ENSMUSP00000108474; ENSMUSG00000057315 [Q8C4V1-3]
ENSMUST00000112854; ENSMUSP00000108475; ENSMUSG00000057315 [Q8C4V1-3]
GeneIDi231532
KEGGimmu:231532
UCSCiuc008yix.2 mouse [Q8C4V1-1]
uc008yiz.1 mouse [Q8C4V1-2]

Keywords - Coding sequence diversityi

Alternative splicing

Entry informationi

Entry nameiRHG24_MOUSE
AccessioniPrimary (citable) accession number: Q8C4V1
Secondary accession number(s): Q8CA50, Q8QZZ0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: March 20, 2007
Last modified: March 28, 2018
This is version 115 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health